Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 0.01 EU/µg as determined by LAL method.

Activity

The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 1-5 ng/ml.

Target Names

KITLG

Uniprot No.

P21583

Research Area

Immunology

Alternative Names

C kit ligand; C-kit ligand; Ckit ligand; DCUA; DFNA69; DKFZp686F2250; familial progressive hyperpigmentation 2; FPH2; FPHH; KIT ligand; Kitl; KITLG; KL 1; KL1; Mast cell growth factor; MGF; MGF stem cell factor; SCF; SCF_HUMAN; SF; SHEP7; sKITLG; Soluble KIT ligand; Steel factor; steel, mouse, homolog of; Stem cell factor; Stem cell factor precursor

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

26-189aa

Complete Sequence

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Mol. Weight

18.4 kDa

Protein Length

Partial

Tag Info

Tag-Free

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Stem cell factor (SCF) drives c-Kit receptor activation to regulate hematopoietic progenitor survival, proliferation, and differentiation, making it indispensable for ex vivo expansion protocols and mast cell biology studies. This tag-free recombinant human KITLG (aa 26–189) demonstrates an ED50 of 1–5 ng/mL in TF-1 erythroleukemic cell proliferation assays, confirming robust signaling potency suitable for JAK/STAT and MAPK pathway activation studies, hematopoietic differentiation experiments, and use as a reference standard in SCF detection assays. The endotoxin level below 1.0 EU/μg eliminates LPS-driven artifacts that confound immune cell functional readouts, supporting use in primary cell proliferation assays and in vivo models of hematopoiesis or tumor biology. Purity exceeding 95% by SDS-PAGE, combined with this stringent endotoxin control, satisfies the criteria typical for antibody development workflows including immunization, ELISA coating, and positive control applications.

Target Background

Function

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Gene References into Functions

Authors show here that cyclin F, a substrate receptor F-box protein for the SCF (Skp1/Cul1/F-box) family of E3 ubiquitin ligases, is a bona fide AKT substrate. PMID: 28954236
A statistically significant relationship was found between stem cell factor level and oocyte maturation, embryo quality, and clinical pregnancy. PMID: 28285567
PAR2 plays a direct role in melanogenesis by increasing SCF secretion from keratinocytes. PMID: 26909822
We did not find any KITLG mutation in two affected individuals with familial progressive hyperpigmentation and hypopigmentation. PMID: 27859606
results suggest that SCF can accelerate cell homing and the maturation of the pulp-dentin complex in human immature teeth. PMID: 27762658
SCF is a critical regulatory factor for conceptus development and implantation during pregnancy in pigs. PMID: 28551414
results revealed that the Th17-mediated inflammatory environment promotes mast cell accumulation through keratinocyte-derived SCF PMID: 28456630
Bone marrow adipocytes synthesize SCF, promoting hematopoietic stem cell proliferation/regeneration. PMID: 28714970
Hypoxia microenvironment in hepatocellular carcinoma up-regulates HIF2/SCF expression, which in turn promotes angiogenesis and HCC metastasis. PMID: 28153790
Insights into the transmembrane helix associations of Kit ligand have been reported. PMID: 28370370
There were no significant differences in CD334-SCF double-positive FB and CD31-SCF double-positive EC levels between the two periapical tissue groups (P > 0.05). CD14-SCF double-positive MP density was considerably higher in periapical granulomas than in cysts (P < 0.01). PMID: 28290616
A significant association of rs995030 of the KITLG gene with the development of testicular germ cell tumors (p = 0.029 for the allele G, p = 0.0124 for the genotype GG) was revealed. PMID: 28064312
Overexpression of SCF is associated with Lewis lung carcinoma. PMID: 26666817
both SCF and IL-31 play an important role in mediating inflammation and enhancing severity of atopic asthma. PMID: 26853551
women with endometriosis have low levels of endometrial SCF PMID: 26791471
results suggested the existence of E2F1-miR-34c-SCF negative feedback loop which was interrupted by the hyper-methylation of miR-34c promoter in CRC cells and increased cell proliferation. PMID: 26704889
IL-1b, which normally bridges innate and adaptive immunity, induces the production of the major haematopoietic/proleukaemic growth factor SCF through the PI-3K/mTOR pathway and the HIF-1a transcription complex. PMID: 25418470
We identified a new heterozygous missense mutation in two families with hyper- and hypopigmentation disorders (p.Thr34Asn and p.Val37Gly, respectively). Of the six affected individuals examined by us, two had cancer. PMID: 26179221
Na+/H+ antiporter inhibition induces cell death in TF-1 erythroleukemia cells stimulated by the stem cell factor PMID: 26188365
IL-7 and SCF are elevated for a prolonged period after double umbilical cord blood transplantation and persistently high levels of these cytokines may correlate with worse clinical outcomes. PMID: 26177551
Allelic Mutations of KITLG, Encoding KIT Ligand, Cause Asymmetric and Unilateral Hearing Loss and Waardenburg Syndrome Type 2. PMID: 26522471
Foxc1 is essential for progenitor cell development and maintenance of bone marrow niches for these cells upregulating CXCL12 and SCF expression and inhibiting of adipogenic processes in cell progenitors. (Review) PMID: 26049754
Results identified SCF as a direct target of HIF-1 in pancreatic cancer. SCF/c-kit promoted invasion and proliferation of pancreatic cancer cells and may be a new target for the treatment of pancreatic cancer. PMID: 25799412
we found that Kl treatment impairs Nodal mRNA expression and Fgf9-mediated Nanos2 induction, reinforcing the antagonistic effect of these two growth factors on the meiotic fate of male germ cells PMID: 25766327
A functional p53 responsive polymorphism in KITLG, rs4590952, does not affect the risk of breast cancer. PMID: 25220285
High SCF expression is associated with metastasis in non-small cell lung cancers. PMID: 25401222
SCF-mediated gamma-globin gene expression in adult human erythroid cells is associated with KLF1, BCL11A and SOX6 down-regulation. PMID: 25457384
overexpression of Snail in PDAC cells increased SCF levels, and the media conditioned by Snail-expressing PDAC cells promoted mast cell migration. PMID: 24944064
Paraffin-embedded, formalin-fixed tissue from 100 consecutive patients with invasive breast cancer was immunohistochemically stained for Ki-67 and Ki-67/KL1. Ki-67 was manually scored in different regions by 2 observers and automated image analysis PMID: 24897070
KIT-L could be now a direct NOBOX target. PMID: 25514101
Stem cell factor is a novel independent prognostic biomarker for hepatocellular carcinoma after curative resection. PMID: 25086759
Together, these data indicate that stem cell factor1-165 is more thermostable than stem cell factor1-141. PMID: 25061857
High KITLG is associated with growth and invasion in colorectal cancer. PMID: 25213795
These findings suggest that integration of SCF and LTD4 signals may contribute to MC hyperplasia and hyper-reactivity during airway hyper-response and inflammation PMID: 25161061
study reports a modulatory role for antimullerian hormone as an ovarian/follicular autocrine/paracrine factor controlling SCF expression via the cAMP/PKA pathway in granulosa cells PMID: 25241372
Gain-of-function mutations in c-Kit result mastocytosis, gastrointestinal stromal tumors and other hematological neoplasms. (Review) PMID: 24745671
Variants of the KITLG enhancer is associated with blond hair color. PMID: 24880339
Data reveal that SCF disrupts the endothelial adherens junction and enhances vascular leakage, and suggest that anti-SCF/cKit therapy may hold promise as a potential therapy for the treatment of hyperpermeable vascular diseases. PMID: 24790137
Data indicate that insulin-like growth factor-1 (IGF1) stimulated s tem cell factor (Kitl/KITLG) protein and mRNA expression and promoter activity by activating several signaling pathways. PMID: 24116170
Cardiomyocyte-specific overexpression of SCF protects the heart from myocardial ischemia reperfusion injury. PMID: 23680593
Data indicate that stem cell factor (SCF) was expressed in differentiating dental pulp. PMID: 23703692
Seborrheic keratosis cells do not respond to IL-1alpha or TNF-alpha to stimulate production of SCF, whereas a significant stimulation of SCF is elicited by those same cytokines in normal human keratinocytes. PMID: 23662587
Study uncovered a single-nucleotide polymorphism in a functional p53-binding site and establish its influence on the ability of p53 to bind to and regulate transcription of the KITLG gene. The SNP resides in KITLG and associates with one of the largest risks identified among cancer genome-wide association studies. PMID: 24120139
N-linked carbohydrate modifiers affect stem cell factor and endothelin-1-stimulated epidermal pigmentation in human epidermal equivalents PMID: 23273644
RIN3 is a negative regulator of mast cell responses to SCF PMID: 23185384
this is the first report to determine the significant contribution of SCF autoproduction to neoplastic proliferation of mast cells PMID: 23125456
A unique requirement for KIT Ligand in the upregulation of glucocorticoid receptor alpha isoform and optimal erythroblast expansion in cultures that mimic stress erythropoiesis. PMID: 22533504
Stem cell factor was expressed in all tumour subgroups, with the highest in oncocytomas and papillary renal cell carcinomas. Stem cell factor correlated positively with the cytoplasmic expression of KIT. PMID: 23060556
Elevated plasma levels of SCF are associated with inflammatory bowel disease with JCV infection. PMID: 22467521
The KITLG (rs4474514) variants were significantly associated with germ cell tumors only in the adolescent age group. PMID: 22072546

Hide All

Involvement in disease

Hyperpigmentation with or without hypopigmentation, familial progressive (FPHH); Deafness, congenital, unilateral or asymmetric (DCUA)

Subcellular Location

[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Single-pass type I membrane protein. Cell projection, lamellipodium. Cell projection, filopodium.; [Soluble KIT ligand]: Secreted.

Protein Families

SCF family

Database Links

HGNC: 6343

OMIM: 145250

KEGG: hsa:4254

STRING: 9606.ENSP00000228280

UniGene: Hs.1048

Code	CSB-AP003741HU
Abbreviation	Recombinant Human KITLG protein, partial (Active)
MSDS	MSDS Datasheet
Size	$166
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Kit ligand (KITLG), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage