Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial

In Stock
Code CSB-AP005131HU
Product Type Immune Checkpoint
Size US$130
Uniprot No. Q07011
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias CD137;ILA;TNFRSF9;4-1BB ligand receptor;CDw137;T-cell antigen 4-1BB homolog;T-cell antigen ILA
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to bind Human TNFSF9 in functional ELISA is less than 50 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Research Area Cancer
Source Mammalian cell
Gene Names TNFRSF9
Expression Region 24-186aa
Tag Info C-terminal 6xHis-FC-tagged
Mol. Weight 44 kDa
Protein Description Extracellular Domain
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.
Subcellular Location Membrane, Single-pass type I membrane protein
Tissue Specificity Expressed on the surface of activated T-cells.
Database Links

HGNC: 11924

OMIM: 602250

KEGG: hsa:3604

STRING: 9606.ENSP00000366729

UniGene: Hs.738942

Related Products

TNFRSF9 Antibodies

TNFRSF9 Antibodies for Homo sapiens (Human)

TNFRSF9 Antibodies for Human

TNFRSF9 Proteins

TNFRSF9 Proteins for Mus musculus (Mouse)

TNFRSF9 Proteins for Homo sapiens (Human)

TNFRSF9 ELISA Kit

TNFRSF9 ELISA Kit for Homo sapiens (Human)

TNFRSF9 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.