Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial (Active)

In Stock
Code CSB-AP005131HU
Product Type Immune Checkpoint
Size $130Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. Q07011
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias CD137;ILA;TNFRSF9;4-1BB ligand receptor;CDw137;T-cell antigen 4-1BB homolog;T-cell antigen ILA
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to bind Human TNFSF9 in functional ELISA is less than 50 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Research Area Cancer
Source Mammalian cell
Gene Names TNFRSF9
Expression Region 24-186aa
Tag Info C-terminal 6xHis-FC-tagged
Mol. Weight 44 kDa
Protein Description Extracellular Domain
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.
Subcellular Location Membrane, Single-pass type I membrane protein
Tissue Specificity Expressed on the surface of activated T-cells.
Database Links

HGNC: 11924

OMIM: 602250

KEGG: hsa:3604

STRING: 9606.ENSP00000366729

UniGene: Hs.738942

Pathway Target Therapy

Related Products

TNFRSF9 Antibodies

TNFRSF9 Antibodies for Homo sapiens (Human)

TNFRSF9 Antibodies for Human

TNFRSF9 Proteins

TNFRSF9 Proteins for Homo sapiens (Human)

TNFRSF9 ELISA Kit

TNFRSF9 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.