Code | CSB-BP014597HU |
Size | Pls inquire other sizes |
Source | Baculovirus |
Code | CSB-EP014597HU-B |
Size | Pls inquire other sizes |
Source | E.coli |
Conjugate | Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag. |
Code | CSB-MP014597HU |
Size | Pls inquire other sizes |
Source | Mammalian cell |
Purity | >85% (SDS-PAGE) |
Target Names | MKI67 |
Uniprot No. | P46013 |
Research Area | Cell Cycle |
Species | Homo sapiens (Human) |
Expression Region | 3120-3256aa |
Target Protein Sequence | NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI |
Mol. Weight | 17.3kD |
Protein Length | Full Length of Mature Protein |
Tag Info | The following tags are available. N-terminal His-tagged and C-terminal Myc-tagged N-terminal His-tagged Tag-Free The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
Form | Lyophilized powder |
Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet | Please contact us to get it. |
Still Have Questions? | Start a Chat |
Function | Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly |
Subcellular Location | Chromosome, Nucleus, Nucleus, nucleolus |
Database Links |
HGNC: 7107 OMIM: 176741 KEGG: hsa:4288 STRING: 9606.ENSP00000357643 UniGene: Hs.689823 |
Recombinant Human Peroxisomal biogenesis factor 19(PEX19) (Active)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Plasma kallikrein(Klkb1),Partial
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Atrial natriuretic peptide receptor 1(NPR1),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Carbonic anhydrase-related protein(CA8)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma(FCER1G),partial
Express system: Yeast
Species: Homo sapiens (Human)
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide