Recombinant Human Antigen KI-67(MKI67) ,partial

Code CSB-BP014597HU
Size Pls inquire other sizes
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP014597HU-B
Size Pls inquire other sizes
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP014597HU
Size Pls inquire other sizes
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity >85% (SDS-PAGE)
Target Names MKI67
Uniprot No. P46013
Research Area Cell Cycle
Alternative Names Antigen identified by monoclonal Ki 67 ; Antigen identified by monoclonal Ki-67; Antigen KI-67; Antigen KI67 ; Antigen Ki67; KI67_HUMAN; KIA; Marker of proliferation Ki-67; MIB 1; MIB; MKI67; PPP1R105; Proliferation marker protein Ki-67; Proliferation related Ki 67 antigen ; Protein phosphatase 1 regulatory subunit 105; RP11-380J17.2
Species Homo sapiens (Human)
Expression Region 3120-3256aa
Target Protein Sequence NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI
Mol. Weight 17.3kD
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly
Gene References into Functions
  1. RAGE, EGFR and Ki-67 were immunohistochemicalyl studied for their expression in biopsy specimens from primary breast tumors PMID: 30139236
  2. High Ki-67 expression is associated with Central Giant Cell Granuloma. PMID: 30139237
  3. Our results identified FGFR3(high)/Ki67(high) papillary pTa tumors as a subgroup with poor prognosis and encourage histological grading as high grade tumors. PMID: 30154342
  4. PD-L1, Ki-67, and p53 staining individually had significant prognostic value for patients with stage II and III colorectal cancer PMID: 28782638
  5. Studies indicate that high Ki-67 expression was correlated with poor prognosis and advanced clinicopathological features, and it could serve as a biomarker for disease management [Review]. PMID: 28287186
  6. High Ki67, EZH2, and SMYD3 immunoexpression, adjusted for standard clinicopathological parameters, independently predicts outcome in patients with prostate cancer, at diagnosis. PMID: 29174711
  7. the combination of the TERT promoter/BRAFV600E mutations and Ki-67 LI is a promising marker to predict recurrence of PTC. PMID: 28150740
  8. p16/Ki-67 dual immunostaining had comparable sensitivity and improved specificity in screening high-grade cervical intraepithelial neoplasm (HGCIN) or CC when compared with hrHPV detection. Further studies may be beneficial to assess the efficacy of this novel biomarker, which can be potentially used as one of the initial screening assays. PMID: 30249873
  9. We show that it is possible to approximate the true Ki67 Index accurately without detecting individual nuclei and also statically demonstrate the weaknesses of commonly adopted approaches that use both tumor and non-tumor regions together while compensating for the latter with higher order approximations PMID: 30176814
  10. Prognosis of luminal breast carcinoma can be predicted using Ki67 as a continuous variable and a standard cut-off value of 14%. Information about the specimen type used to determine ki67 should be recorded in the pathological report PMID: 28865009
  11. Ki-67 and TOPO 2A expression correlated with tumour size and tumour invasiveness in somatotropinomas. PMID: 29334118
  12. The aim of this study was to investigate the expression of p16 and SATB1 proteins in regard to expression of the Ki-67 antigen and available clinicopathological data (i.a. receptor status, staging and grading PMID: 29936452
  13. Data suggest that Ki-67 is a strong prognostic factor for overall survival (OS) and disease-free survival (DFS) and should be included in all pancreatic neuroendocrine tumor pathology. PMID: 29351120
  14. Ki-67-a proliferation marker is easily identified and provides comparable accurate information. In contrast to poor reproducibility of mitotic counts, Ki-67 can achieve high agreement between pathologists; is more reproducible; adds complementary value to the MBR grading system and correlates well with other clinicopathologic parameters. PMID: 29893312
  15. High Ki-67 expression is associated with papillary thyroid carcinoma. PMID: 29855303
  16. This study demonstrated that p16/Ki-67 dual staining represents an effective method for cervical cancer screening. Application of this method could lead to a reduction of unnecessary colposcopy referrals and misdiagnosis. PMID: 29758205
  17. In human adenocarcinoma tissues, PFKFB3 and Ki67 protein levels were related to the clinical characteristics and overall survival PMID: 29327288
  18. In leukoplakia, the expression of survivin associated with that of ki-67 reinforces the assumption that all these lesions are potentially malignant. PMID: 28346726
  19. High Ki67 expression in the index prostate cancer lesion is an independent predictor of biochemical recurrence in patients with positive surgical margin following radical prostatectomy. PMID: 29506507
  20. Ki-67 expression level failed to have a markedly significant impact on survival in patients with extensive-stage small cell lung cancer PMID: 28589765
  21. p16/Ki-67 dual staining can increase the efficiency of screening methods for cervical cancer. PMID: 29895125
  22. both the value and the level of Ki-67 expression were correlated positively with the normalized iodine concentration (NIC) values (r=0.344, P=0.002 and r=0.248, P=0.026); HIF-1alpha expression was correlated positively with the NIC values of the RC (r=0.598, P<0.001) PMID: 29103468
  23. According to immunohistochemistry and immunoblot analysis, the expression levels of cyclin D1, cyclin E, pRb, and Ki67 in psoriasis lesions decreased after treatment and were similar with those in the normal group PMID: 29115643
  24. Studies suggest that Ki-67 acts as an organiser of chromosome periphery region [Review]. PMID: 28838621
  25. High Ki-67 immunohistochemical expression levels in distant metastatic lesions were independently associated with poorer overall survival outcomes after biopsy of recurrence lesion in breast cancer patients. PMID: 28425014
  26. Data show there was no trend to higher Ki-67 antigen in metastatic than primary pancreatic neuroendocrine tumors (NETs). PMID: 28984786
  27. Data suggest that Ki-67 antigen proliferative index has important limitations and hhosphohistone H3 (PHH3) is an alternative proliferative marker. PMID: 29040195
  28. A high Ki-67 LI correlated significantly with a worse prognosis in gastric cancer (GC)patients. Further cumulative studies for the optimal cutoff value for high Ki-67 LI are needed before application in clinical practice. PMID: 28561880
  29. Ki67 expression in gastric carcinoma is directly correlated with the tumor grade and depth of invasion. PMID: 28965621
  30. In ACTH-secreting pituitary tumors, Ki-67 was expressed in 7 of 28 recurrent tumors and 8 of 27 nonrecurrent tumors, and there was no staining in normal pituitary samples. It was expressed predominantly in the nucleus of the tumor cells. There was no significant difference between Ki67 expression between the nonrecurrent group and the recurrent group. PMID: 29432944
  31. Adjuvant chemotherapy was 9% less likely to be recommended by a multidisciplinary board when using the current criteria compared with using a combination of the St. Gallen criteria and Ki67 and uPA/PAI-1 status (P = 0.03). Taken together, our data show discordance among markers in identifying the risk of recurrence, even though each marker may prove to be independently valid. PMID: 28954632
  32. The different values of the cycling nuclear area major dimension may also be connected with the biological behaviour of the three examined groups. Moreover, the endometrial epithelial cells may follow a Ki-67 increase pathway, instead of the relatively stable pathway which the rapidly proliferating adenocarcinoma cells may use. PMID: 28737230
  33. Age-associated expression of the proliferation and immature neuron markers MKI67 and DCX, respectively, was unrelated, suggesting that neurogenesis-associated processes are independently altered at these points in the development from stem cell to neuron. PMID: 28766905
  34. High Ki-67 expression in localized PCa is a factor of poor prognosis for prostate cancer PMID: 28648414
  35. Dual p16 and Ki-67 expression can be used in cervical screening of HPV-positive women. PMID: 29566392
  36. The expression of alpha-enolase, Ki67 and p53 in pancreatic cancer and adjacent normal tissues were evaluated by IHC using the corresponding primary antibodies on the commercial tissue arrays PMID: 28824297
  37. All cases of DF showed much higher Ki67 proliferation index (P = 0.0001) along with increased mitotic figures both on H&E and with anti-PHH3 PMID: 28609344
  38. We performed immunohistochemistry for Ki67, p16INK4a, and WNT5A in human HPs ( hyperplastic polyps), sessile serrated adenomas/polyps (SSA/Ps), and traditional serrated adenomas (TSAs) .The distribution of Ki67 and p16INK4a positive cells in TSAs was different from that in HPs and SSA/Ps. PMID: 28627675
  39. Ki-67 expression in ureteroscopic biopsy specimens is potentially helpful in clinical decision making for patients with suspected upper urinary tract urothelial carcinoma. PMID: 28554752
  40. For patients with ER+/HER2- breast cancer, three distinct risk patterns by Ki67-LI levels were confirmed according to the 2015 St Gallen consensus. For patients with clearly low or high Ki67-LI, straightforward clinical decisions could be offered, but for patients with intermediate Ki67-LI, other factors might provide valuable information. PMID: 28061893
  41. Data suggest that Ki-67 index and survivin may be useful biomarkers for rectal cancer with preoperative chemoradiotherapy. PMID: 29491110
  42. IHC based post-Ki67 levels may have distinct predictive power compared with the naive IHC Ki67. PMID: 28412725
  43. Ten international pathology institutions participated in this study and determined messenger RNA expression levels of ERBB2, ESR1, PGR, and MKI67 in both centrally and locally extracted RNA from formalin-fixed, paraffin-embedded breast cancer specimens with the MammaTyper(R) test. Samples were measured repeatedly on different days within the local laboratories, and reproducibility was assessed by means of variance comp... PMID: 28490348
  44. Our data support Ki67 evaluation to estimate non-small-cell lung cancer (NSCLC) patients' prognosis, particularly for adenocarcinoma. PMID: 26272457
  45. p16/Ki-67 co-expressions associated strongly with high-risk human papillomavirus persistence, especially with HPV16/18, and could be considered as a suitable biomarker for cervical cancer screening PMID: 27588487
  46. high expression of VEGF and Ki-67 were independent poor prognostic factors for overall survival in adenoid cystic carcinoma PMID: 26194375
  47. Proliferative markers-mitotic count and Ki67 index-have limited value to predict recurrence or metastasis in congenital mesoblastic nephromas with a cellular component PMID: 27484189
  48. KI-67 expression correlates with SATB1 expression in non-small cell lung carcinoma. PMID: 29374696
  49. Ki-67 may be of diagnostic value in distinguishing between partial and complete hydatidiform moles PMID: 29374747
  50. Ki-67 proliferation index (P = 0.027) proved to be independent prognostic factors PMID: 27049832
  51. p16/Ki-67 dual-stained cytology may serve as a more objective alternative to Pap cytology for triage of high-risk HPV-positive women. PMID: 27150161
  52. The present work aims to investigate the relationship between the expression of AEG-1(astrocyte elevated gene-1), b-FGF(basic-fibroblast growth factor), beta-catenin, Ki-67, TNF-alpha (tumor necrosis factor-alfa) other prognostic parameters in DC (Ductal Carcinomas) and ductal intraepithelial neoplasm. We found a relationship between these factors. PMID: 26096243
  53. Data show that comparing with Ki-67 and TOP2A, RacGAP1 allowed for a clearer prognostic statement. PMID: 27259241
  54. Our results suggest that the ADC values on DW-MRI may be used as a measurement of cell proliferation and hypoxia in RC. J. Magn. Reson. Imaging 2016;44:594-600. PMID: 26919464
  55. Response to chemotherapy in neuroendocrine tumors increases with Ki-67 index, but Ki-67 alone is an unreliable means to select patients for chemotherapy. PMID: 27412968
  56. high Ki67/BCL2 index significantly correlated with advanced stage, recurrence, intestinal type, high histologic grade, and lymphatic and perineural invasion in gastric adenocarcinoma PMID: 28273657
  57. the overexpression of USP7 might promote cell proliferation by deubiquitinating Ki-67 protein PMID: 27590858
  58. The results demonstrate that high expression of Ki-67 contributes to radiation resistance and acts a poor prognosis indicator in patients with locally advanced nasopharyngeal carcinoma. PMID: 28947213
  59. Here the authors show how Ki-67 and RepoMan form mitotic exit phosphatases by recruiting PP1, how they distinguish between distinct PP1 isoforms and how the assembly of these two holoenzymes are dynamically regulated by Aurora B kinase during mitosis. PMID: 27572260
  60. Ki-67 before and after NAC, as well as the change of Ki-67 before and after NAC might be prognostic factors for OS and DFS for breast cancer patients. PMID: 28088868
  61. Ki67 depletion results in the dissociation of both pre-ribosomal RNAs and nucleolar proteins from the perichromosomal layer (PCL), which indicates that Ki67 is required for the PCL accumulation of pre-ribosomal RNAs, to which several nucleolar proteins are associated. PMID: 28935370
  62. Variants near TTN and CCDC8 were associated with KI67 expression, and rs2288563 and rs2562832 in TTN are potential biomarkers for the prediction of clinical outcomes in hepatitis B-related hepatocellular carcinoma patients. PMID: 28700999
  63. suggest that upregulation of NG2/CSPG4 rather than changes in CD44 or Ki-67 expression is associated with low overall survival in glioblastoma multiforme patients, supporting NG2/CSPG4 as a potential prognostic marker in glioblastoma PMID: 28945172
  64. There are considerable differences between the different Ki-67 antibodies in their capacity to detect proliferating tumor cells and to separate low- and high-risk breast cancer patient groups. PMID: 28188752
  65. Study shows that a Ki67 increase occurs in a significant proportion of patients with entero-pancreatic neuroendocrine neoplasms at time of disease progression, particularly in those with pancreatic origin. PMID: 28644861
  66. Anillin (ANLN) expression in tumor cells is correlated to poor prognosis in breast cancer patients, independent of Ki-67 or tumor size. PMID: 27863473
  67. Differences in Ki67 expressions between pre- and post-neoadjuvant chemotherapy specimens might predict early recurrence of breast cancer. PMID: 28237784
  68. Neoadjuvant therapy in microsatellite-stable colorectal carcinoma induces concomitant loss of MSH6 and Ki-67 expression. PMID: 28232158
  69. Expression of topoisomerase IIalpha and mitosin was significantly higher in recurrent meningioma than in non-recurrent meningioma (P PMID: 28301542
  70. Intraobserver reproducibility ranged from very good to perfect for both methods. Our results suggested that specimen-specific cut-off value should be applied for both scoring methods PMID: 26509909
  71. Upregulation of RAD51 and overexpression of Ki67 may be associated with the progression of thyroid cancer. PMID: 28502582
  72. Tumor size, lymph node involvement, family history, Ki-67 and p53 are independent variables associated with either DFS or OS. Triple-negative breast cancer (TNBC) patients with positive p53 or Ki-67 high index or family history of cancer have a significant association with worse prognosis. This study suggests that p53, Ki-67 and family history are useful prognostic markers in TNBC. PMID: 28235003
  73. Report reliability of manual and digital image analysis of Ki67 labeling index in adrenocortical carcinoma. PMID: 26980031
  74. Findings from this large-scale multicentre analysis with centrally generated automated KI67 scores show strong evidence in support of a prognostic value for automated KI67 scoring in breast cancer. PMID: 27756439
  75. Immunochemical detection of the protein p16INK4a in cervical cytology is used in combination with Ki-67. PMID: 28521315
  76. Results suggest that Ki-67 expression can be a good prognostic biomarker for early gastric cancer but not for advanced gastric cancer. Furthermore, Ki-67 expression is a better prognostic marker in gastric cancers with well-differentiated histology. PMID: 28640099
  77. Grading of pancreatic neuroendocrine tumors is currently based on mitotic rate and Ki67 proliferation index. The results suggest that Phosphohistone-H3 is an effective marker for determining mitotic activity and can be used alternative to Ki67. PMID: 28651471
  78. though TK1 expression was an independent prognostic factor for relapse, but not for survival, TK1 is a more informative expression than Ki-67 for LI, relapse and overall survival rates. Thus, when TK1 is combined with MDACC grading, pTNM staging and lymph node metastasis, IHC determination of TK1 expression may improve the overall prediction of prognosis in patients with ovarian cancer. PMID: 28651488
  79. The endometrial expression of PR and Ki67 along with serum CA125 predicted the development of lymph node metastasis in endometrial cancer. PMID: 27163153
  80. the expression of PSMB4 was significantly increased in the human EOC (epithelial ovarian cancer)tissues and was correlated with Ki-67. PMID: 26439929
  81. the combination therapy upregulated the expression level of p-p53 in vitro and decreased Ki-67 expression in vivo PMID: 28513299
  82. High Ki67 expression is only present in 6.8% of CaP patients and is predictive of reduced survival and increased risk of metastasis, independent of PSA, Gleason score and D'Amico risk category. DLX2 is a novel marker of increased metastasis risk found in 73% patients and 8.2% showed co-expression with a high Ki67 score PMID: 27336609
  83. High Ki-67 expression Correlates with Breast Cancer. PMID: 28373466
  84. Ki-67 antigen gene expression correlated with overall survival in patients with malignant cutaneous melanoma. PMID: 27543214
  85. In localized PC treated by radical prostatectomy, higher Ki67 PI assessed using a clinical grade automated algorithm is strongly associated with a higher GS, stage, SVI and ECE and greater probability of recurrence. PMID: 27136741
  86. This study showed that the overexpressions of Ki67, RacGAP1, and TOP2a affect the prognosis of female breast cancer patients adversely PMID: 27284123
  87. MIB-1 confirms that a small proportion (19%) of congenital choledochal malformation has marked epithelial proliferation but no clinical correlates could be identified. PMID: 27114310
  88. High Ki-67 before NAC was a predictor for pCR in neoadjuvant setting for breast cancer patients. PMID: 28075166
  89. the expression of p53, p16 and Ki67 in 91 cases of cutaneous squamous cell carcinoma and its precursors, was investigated. PMID: 27833960
  90. High grade ductal intraepithelial neoplasia lesions show haphazard Ki67 staining while low grade ductal intraepithelial neoplasia lesions show basal/peripheral Ki67 staining in the proliferating epithelial cells. PMID: 27499154
  91. Using p53 and/or Ki-67 in addition to cytology increases the specificity without penalising the sensitivity PMID: 27873391
  92. The addition of p16/Ki-67 to HPV DNA testing leads to a more accurate stratification of CIN in women presenting with minor cytological abnormalities. PMID: 26932360
  93. High Ki67 expression is associated with Cervical Squamous Intraepithelial Lesions and Cancer. PMID: 27509952
  94. Innon-muscle-invasive bladder cancer expression of ESR1, ERBB2 and MKI67 are significantly different between stage and grade PMID: 27514658
  95. CD44(+)ALDH1(+)Ki-67(-) tumor cells may favor distant metastasis; quiescence may have a crucial role for tumor progression, treatment resistance and metastatic ability of breast cancer stem cells PMID: 27630305
  96. high Ki-67 expression was associated with poor survival in patients with Upper tract urinary carcinoma. PMID: 28006766
  97. Describe hot-spot selection algorithm with an extended context-based analysis of whole slide images and hot-spot gradual extinction algorithm for analysis of Ki-67 staining in meningiomas. PMID: 27717363
  98. Optimal tissue sampling for immunohistochemical Ki67 biomarker evaluation is dependent on the heterogeneity of the tissue under study. PMID: 27576949
  99. experiments presented confirmed that Ki67 plays a role in the formation and maintenance of mitotic chromosome architecture PMID: 27610954
  100. TOP2A and Ki-67 antibodies may be used in combination for cervical cancer screening in immunocytochemistry assays. PMID: 27175798

Show More

Hide All

Subcellular Location Chromosome, Nucleus, Nucleus, nucleolus
Database Links

HGNC: 7107

OMIM: 176741

KEGG: hsa:4288

STRING: 9606.ENSP00000357643

UniGene: Hs.689823

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1