Recombinant Human Delta-like protein 3(DLL3),partial

In Stock
Code CSB-YP882142HU
Product Type Recombinant Protein
Size US$2010Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. Q9NYJ7
Abbreviation DLL3
Relevance Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP882142HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) DLL3.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP882142HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) DLL3.
Storage Buffer Tris-based buffer,50% glycerol
Alias Drosophila Delta homolog 3 ;Delta3
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL
Research Area Developmental Biology
Source Yeast
Gene Names DLL3
Protein Names Recommended name: Delta-like protein 3 Alternative name(s): Drosophila Delta homolog 3 Short name= Delta3
Expression Region 27-492aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 50.5kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm (By similarity).
Involvement in disease Spondylocostal dysostosis 1, autosomal recessive (SCDO1)
Subcellular Location Membrane, Single-pass type I membrane protein
Database Links

HGNC: 2909

OMIM: 277300

KEGG: hsa:10683

STRING: 9606.ENSP00000205143

UniGene: Hs.127792

Pathway Notch signaling pathway
Th1 and Th2 cell differentiation

Q&A and Customer Reviews

Q&A
Q:

I have a question for item CSB-YP882142HU Recombinant human Delta-like protein 3, lyophilized and glycerol free.
Do you have instructions on how this item should be reconstituted that you could share?

A:
Very nice to receive your inquiry. We have listed recommended reconstitution method in COA. Please kindly check the datasheet&COA.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.
We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Q:

I have a questions about item CSB-YP882142HU Recombinant human Delta-like protein 3 and ask:
What strain of yeast is used to produce this protein?

A:
Thanks for your inquiry,We use Pichia to produce this protein.
Q:

We are interested in CSB-YP882142HU - Recombinant human Delta-like protein 3 supplied in a lyophilized form without glycerol. Would it be possible to obtain this product in such a form?

A:
Very nice to receive your inquiry.
If you would like this protein supplied in lyophilized form without glycerol, please kindly remark this requirement when sending your PO.
Q:

Would you be able to share how CSB-YP882142HU - Recombinant human Delta-like protein 3 was validated? Was an antibody used to detect this protein? If so, which antibody?

A:
Very nice to receive your inquiry.
1) In the cloning phase, we determine that there is no problem with clones by Sequencing.
2) In the protein expression stage, we perform SDS-PAGE detection.
3) We haven't used antibody to test this protein yet. If customer has demand, we could perform Western Blot free of charge.
We will use our home-made specific antibody (CSB-PA882142LA01HU) or His-tag antibody to test this protein in WB.
Please kindly remark this requirement when sending your PO.
Customer Reviews

Related Products

DLL3 Antibodies

DLL3 Antibodies for Human

DLL3 Proteins

DLL3 Proteins for Homo sapiens (Human)

DLL3 ELISA Kit

DLL3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.