Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial

In Stock
Code CSB-EP011087HU
Abbreviation Recombinant Human IGF1R protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Alternative Names
CD221; CD221 antigen ; IGF 1 receptor; IGF 1R; IGF I receptor; IGF-I receptor; Igf1r; IGF1R_HUMAN; IGFIR; IGFIRC; IGFR; Insulin like growth factor 1 receptor; Insulin like growth factor 1 receptor precursor; Insulin-like growth factor 1 receptor beta chain; Insulin-like growth factor I receptor; JTK13; MGC142170; MGC142172; MGC18216; Soluble IGF1R variant 1; Soluble IGF1R variant 2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
763-931aa
Target Protein Sequence
YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.4kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant human IGF1R production in E. coli starts with co-cloning the target gene into an expression vector with an N-terminal GST-tag gene, which is introduced into E. coli cells. The target gene encodes the 763-931aa of human IGF1R. These cells are grown and induced for protein expression. The cells are lysed to release the protein, which is purified using affinity chromatography. Protein purity is checked using SDS-PAGE, exceeding 90%.

The IGF1R is a transmembrane glycoprotein with an intrinsic kinase moiety [1]. IGF1R is crucial in various physiological processes, including growth, development, and metabolism. Studies have shown that mutations in the IGF1R gene can lead to growth retardation both during intrauterine development and postnatally [2][3]. IGF1R can influence longevity. Evidence has indicated that certain mutations in the IGF1R gene are associated with increased lifespan [4][5].

IGF1R regulates cellular signaling pathways, such as the PI3K/AKT/mTOR pathway and the Raf/MEK/ERK pathway [6]. IGF1R is implicated in cancer progression. Research has demonstrated that IGF1R is linked to breast cancer metastasis and is a potential target for cancer vaccines [7][8]. IGF1R has been related to have a dual role in breast cancer, where both activation and inhibition of IGF1R can impact tumor development [9].

References:
[1] T. Kruis, J. Klammt, A. Galli-Tsinopoulou, T. Wallborn, M. Schlicke, E. Mülleret al., Heterozygous mutation within a kinase-conserved motif of the insulin-like growth factor i receptor causes intrauterine and postnatal growth retardation, The Journal of Clinical Endocrinology & Metabolism, vol. 95, no. 3, p. 1137-1142, 2010. https://doi.org/10.1210/jc.2009-1433
[2] F. Peng, I. Schwartz, B. Johnson, M. Derr, C. Roberts, V. Hwaet al., Familial short stature caused by haploinsufficiency of the insulin-like growth factor i receptor due to nonsense-mediated messenger ribonucleic acid decay, The Journal of Clinical Endocrinology & Metabolism, vol. 94, no. 5, p. 1740-1747, 2009. https://doi.org/10.1210/jc.2008-1903
[3] J. Choi, M. Kang, G. Kim, M. Hong, H. Jin, B. Leeet al., Clinical and functional characteristics of a novel heterozygous mutation of theigf1rgene and igf1r haploinsufficiency due to terminal 15q26.2->qter deletion in patients with intrauterine growth retardation and postnatal catch-up growth failure, The Journal of Clinical Endocrinology & Metabolism, vol. 96, no. 1, p. E130-E134, 2011. https://doi.org/10.1210/jc.2010-1789
[4] Y. Suh, G. Atzmon, M. Cho, D. Hwang, B. Liu, D. Leahyet al., Functionally significant insulin-like growth factor i receptor mutations in centenarians, Proceedings of the National Academy of Sciences, vol. 105, no. 9, p. 3438-3442, 2008. https://doi.org/10.1073/pnas.0705467105
[5] C. Tazearslan, J. Huang, N. Barzilai, & Y. Suh, Impaired igf1r signaling in cells expressing longevity-associated human igf1r alleles, Aging Cell, vol. 10, no. 3, p. 551-554, 2011. https://doi.org/10.1111/j.1474-9726.2011.00697.x
[6] S. Wei, K. Wang, X. Yang, W. Dai, & Z. Fan, Long non‑coding rna bancr mediates esophageal squamous cell carcinoma progression by regulating the�igf1r/raf/mek/erk pathway via mir‑338‑3p, International Journal of Molecular Medicine, 2020. https://doi.org/10.3892/ijmm.2020.4687
[7] A. Obr, J. Bulatowicz, Y. Chang, V. Ciliento, A. Lemenze, K. Maingretteet al., Breast tumor igf1r regulates cell adhesion and metastasis: alignment of mouse single cell and human breast cancer transcriptomics, Frontiers in Oncology, vol. 12, 2022. https://doi.org/10.3389/fonc.2022.990398
[8] C. Giovanni, L. Landuzzi, A. Palladini, M. Ianzano, G. Nicoletti, F. Ruzziet al., Cancer vaccines co-targeting her2/neu and igf1r, Cancers, vol. 11, no. 4, p. 517, 2019. https://doi.org/10.3390/cancers11040517
[9] J. Bulatowicz and T. Wood, Activation versus inhibition of igf1r: a dual role in breast tumorigenesis, Frontiers in Endocrinology, vol. 13, 2022. https://doi.org/10.3389/fendo.2022.911079

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation, and tyrosines phosphorylation of multiple substrates, that function as signaling adapter proteins including, the insulin-receptor substrates (IRS1/2), Shc and 14-3-3 proteins. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways: the PI3K-AKT/PKB pathway and the Ras-MAPK pathway. The result of activating the MAPK pathway is increased cellular proliferation, whereas activating the PI3K pathway inhibits apoptosis and stimulates protein synthesis. Phosphorylated IRS1 can activate the 85 kDa regulatory subunit of PI3K (PIK3R1), leading to activation of several downstream substrates, including protein AKT/PKB. AKT phosphorylation, in turn, enhances protein synthesis through mTOR activation and triggers the antiapoptotic effects of IGFIR through phosphorylation and inactivation of BAD. In parallel to PI3K-driven signaling, recruitment of Grb2/SOS by phosphorylated IRS1 or Shc leads to recruitment of Ras and activation of the ras-MAPK pathway. In addition to these two main signaling pathways IGF1R signals also through the Janus kinase/signal transducer and activator of transcription pathway (JAK/STAT). Phosphorylation of JAK proteins can lead to phosphorylation/activation of signal transducers and activators of transcription (STAT) proteins. In particular activation of STAT3, may be essential for the transforming activity of IGF1R. The JAK/STAT pathway activates gene transcription and may be responsible for the transforming activity. JNK kinases can also be activated by the IGF1R. IGF1 exerts inhibiting activities on JNK activation via phosphorylation and inhibition of MAP3K5/ASK1, which is able to directly associate with the IGF1R.; When present in a hybrid receptor with INSR, binds IGF1. PubMed:12138094 shows that hybrid receptors composed of IGF1R and INSR isoform Long are activated with a high affinity by IGF1, with low affinity by IGF2 and not significantly activated by insulin, and that hybrid receptors composed of IGF1R and INSR isoform Short are activated by IGF1, IGF2 and insulin. In contrast, PubMed:16831875 shows that hybrid receptors composed of IGF1R and INSR isoform Long and hybrid receptors composed of IGF1R and INSR isoform Short have similar binding characteristics, both bind IGF1 and have a low affinity for insulin.
Gene References into Functions
  1. MiR133a and miR133b may bind near rs1815009, and miR455 near rs2684788, within IGF1R 3'UTR. PMID: 30365147
  2. study confirms the utility of proximity-labeling methods, such as BioID, to screen for interactors of cell-surface receptors and has uncovered a role of one of these interactors, SNX6, in the IGF1R signaling cascade. PMID: 29530981
  3. Elevations of TGF-beta3, SMAD2 and SMAD4 in hypertrophic scars and increase of IGF-1R in immature stages may give some clues for acne hypertrophic scar formation. PMID: 30167815
  4. miR-30a-5p could influence chemo-resistance by targeting IGF1R gene in melanoma cells, which might provide a potential target for the therapy of chemo-resistant melanoma cells. PMID: 29642855
  5. IGF-1R signalling contributes to T cell dependent inflammation in arthritis. Inhibition of IGF-1R on the level of insulin receptor substrates alleviates arthritis by restricting IL6-dependent formation of Th17 cells and may open for new treatment strategies in rheumatoid arthritis. PMID: 28583713
  6. Novel G310D variant in the insulin-like growth factor 1 receptor gene is associated with type 2 diabetes. PMID: 29470850
  7. higher IGF-IR mRNA expression observed in obese children, associated with the higher IGF-I and ALS and the lower IGFBP-1 levels PMID: 29150385
  8. Study results revealed that microRNA-320a suppresses tumor cell growth and invasion of human breast cancer by targeting IGF-1R. PMID: 29989645
  9. miR539 may inhibit the aggressive behaviour of PDAC by directly targeting IGF1R and may serve as a novel therapeutic target for patients with this disease PMID: 29901181
  10. Data suggest that NEAT1, SRC3, and IGF1R are highly expressed in prostate cancer cells; NEAT1 appears to interact with SRC3 and promote cell proliferation via up-regulation of SRC3/IGF1R/AKT signaling pathway. (NEAT1 = nuclear paraspeckle assembly transcript-1; SRC3 = steroid receptor coactivator protein-3; IGF1R = insulin-like growth factor 1 receptor) PMID: 29225160
  11. Results showed that the expression of IGF1R appears to be highly correlated with the expression of ABCG2 in osteosarcoma and with the expression of CD44 in osteosarcoma patients under age of 10. PMID: 29892839
  12. Here the authors report a nodal role of IGF-IR in the regulation of ERalpha-positive breast cancer cell aggressiveness and the regulation of expression levels of several extracellular matrix molecules. PMID: 28079144
  13. Long noncoding RNA PVT1 enhances the expression of IGF1R through competitive binding to miR-30a. PMID: 29803929
  14. The association between the growth hormone-insulin-like growth factor-1 (GH-IGF-1) axis gene polymorphisms and short stature in Chinese children. PMID: 29687007
  15. High IGF1R expression is associated with non-small cell lung cancer. PMID: 29328495
  16. Our findings suggest that CKS1BP7 as well as IGF1R may serve as potential biomarkers for early detection and predict prognosis in breast cancer. PMID: 28439706
  17. High IGF-IR expression is associated with Ras and BRAF mutations in Hepatocellular Carcinoma. PMID: 28188432
  18. MicroRNA-381 inhibits cell proliferation and invasion in endometrial carcinoma by targeting the IGF-1R. PMID: 29257334
  19. IGF-1R and AKT inhibitors further increased apoptosis by Nutlin-3a in parental MHM cells and the cisplatin-resistant clones, confirming IGF-1R/AKT signaling promotes apoptosis resistance. PMID: 28696156
  20. autocrine IGF2 constitutively activated IGF1R and Akt phosphorylation, which was inhibited by BI 885578 treatment. BI 885578 significantly delayed the growth of IGF2-high colorectal cancer xenograft tumors in mice, while combination with a VEGF-A antibody increased efficacy and induced tumor regression. PMID: 28729397
  21. These findings demonstrated that hMSCCMmediated neuroprotection was attributed to IGF1Rmediated signaling, potentiated via the inhibition of IGF2 by IGFBP6. The results of the present study provide insight into the mechanism by which hMSC administration may promote recovery from nerve injury. PMID: 29039467
  22. loss of miR-99a in ESCC promoted the tumor cell proliferation, migration, invasion and slug-induced EMT through activating IGF1R signaling pathway. PMID: 28800315
  23. current data demonstrate that both INSR and IGF1R are directly targeted by C-myc and exert similar effects to promote the tumorigenesis and metastasis of TSCC through the NF-kappaB pathway. PMID: 29518496
  24. WP760 downregulated IGF1R. PMID: 28417283
  25. a cross-talk between IGF1R and Wnt/beta-catenin signaling pathways and showed, for the first time, that IGF1R is associated with upregulation of TCF-mediated beta-catenin transcriptional activity. PMID: 29621572
  26. MicroRNA-Dependent Regulation of IGF1R Gene Expression in Hormone-Sensitive and Hormone-Resistant Prostate Cancer Cells PMID: 29779108
  27. In contrast to preclinical studies that suggest a decrease in trastuzumab sensitivity in IGF1R(+) tumors, our adjuvant data show benefit of adding trastuzumab for patients with either IGF1R(+) and IGF1R(-) breast tumors. PMID: 28348046
  28. The findings demonstrate that miR-186 acts as a tumor suppressor by targeting IGF-1R in glioma. PMID: 28944896
  29. Forced expression of Klotho resulted in decline of activation of IGF-1R signaling, accompanied by decreased phosphorylation of its downstream targets, including AKT and ERK1/2. These data indicated that Klotho acts as a tumor suppressor via inhibiting IGF-1R signaling, thus suppressing the viability and promoting apoptosis in Tcell lymphoma. PMID: 28656297
  30. The study concluded that the expression modulation of tumor suppressors MIR-375 and MIR-145, and oncomiR MIR-224 have the ability to induce apoptosis of colorectal carcinoma cells through regulation of apoptosis mediating genes MTDH, MAP3K1, PDK1, BCL-XL and BAX. PMID: 28802228
  31. activation of the IGF-IR/PI3K/Akt signaling system is a common pattern in MLS which appears to be transcriptionally controlled, at least in part by induction of IGF2 gene transcription in a FUS-DDIT3-dependent manner. PMID: 28637688
  32. implantation of IGF1R(+) human dental pulp mesenchymal stem cells exerted enhanced neuroplasticity via integrating inputs from both CXCR4 and IGF1R signaling pathways. PMID: 27586516
  33. Study findings indicate that the T allele of IGF1R variant rs2016347 is associated with a significant reduction in breast cancer risk in women with a history of preeclampsia, most marked for HR+ breast cancer and in women with age at first birth less than 30. PMID: 28822014
  34. Study suggests that IGF-1R-AKT signalling imparts functional heterogeneity in cancer stem cells during acquirement of chemoresistance in ovarian carcinoma. PMID: 27819360
  35. IGF1R mRNA expression levels were reversely correlated with miR503 expression levels in breast tumors, suggesting that the upregulation of IGF1R may be due to downregulation of miR503 in breast cancer. PMID: 28656281
  36. miR-497 and miR-99a synergistically target IGF1R and mTOR, thereby impeding the HCC tumor growth. These results promote a concept in which not one single miRNA, but rather a network of miRNAs with shared and individual mRNA targets participates in the hepatocarcinogenesis. PMID: 28624790
  37. MiR379 acts as a tumor suppressor in NSCLC by directly targeting IGF1R. PMID: 28731178
  38. these results indicate that miR455 is involved in gastric cancer progression by directly targeting IGF1R and may serve as a novel therapeutic target for the treatment of gastric cancer. PMID: 28714005
  39. Tumor cells in CSF express IGF1R in High Risk, Metastatic Medulloblastoma. PMID: 27255663
  40. Insulin-like growth factor 1 receptor, associate of Myc 1, and peroxisome proliferator-activated receptor gamma coactivator 1beta are direct targets of miR-139 PMID: 26868851
  41. THADA fusion is a mechanism of IGF2BP3 activation and IGF1R signaling in thyroid cancer. PMID: 28193878
  42. In addition to conventional methods, IGF1R CNV can be identified from WES data. FACS analysis of live primary cells is a promising method for efficiently evaluating and screening for IGF1R haploinsufficiency. PMID: 28395282
  43. The T IGFR-1 genetic variant and a combination of the C VEGF-A and T IGFR-1 genetic variants increase the risk of developing Primary Open Angle Glaucoma. PMID: 28745651
  44. In endocrine-sensitive breast cancer cells, insulin was not growth stimulatory, likely due to the presence of hybrid InsR/IGF1R, which has high affinity for IGF-I, but not insulin. Combination inhibition of InsR and IGF1R showed complete suppression of the system in endocrine-sensitive breast cancer cells PMID: 28468775
  45. lower IGF-1R expression after teriparatide was associated with higher body fat, suggesting links between teriparatide resistance, body composition, and the GH/IGF-1 axis. PMID: 28218468
  46. Study showed that IGF-1 receptor (IGF-1R), which mediates survival pathways upon IGF binding, was highly expressed in oculomotor neurons and on extraocular muscle endplate. PMID: 27180807
  47. the present study confirmed the tumor suppressor function of miR-455 in melanoma, and demonstrated that miR-455 suppressed proliferation and invasion through directly targeting IGF-1R. PMID: 28440508
  48. IGF1R signaling under the given experimental conditions and NSCLC genetic background dictates the functional endpoint mechanism for TKI resistance. Manipulating this regulatory role of IGF1R can force the functional endpoint mechanism for TKI resistance in a defined and targetable direction here illustrated by the observed MET-amplification. PMID: 28418902
  49. Report complex relationships between individual tumor-specific expression of IGF1R/pIGF1R and InsR/pInsR, response endocrine treatment and breast cancer prognosis. PMID: 28030849
  50. These data imply the potential clinical application of EGF-LDP-IGF-AE for esophageal squamous cell carcinoma (ESCC)patients with EGFR and/or IGF-1R overexpression PMID: 28498434

Show More

Hide All

Involvement in disease
Insulin-like growth factor 1 resistance (IGF1RES)
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Protein kinase superfamily, Tyr protein kinase family, Insulin receptor subfamily
Tissue Specificity
Found as a hybrid receptor with INSR in muscle, heart, kidney, adipose tissue, skeletal muscle, hepatoma, fibroblasts, spleen and placenta (at protein level). Expressed in a variety of tissues. Overexpressed in tumors, including melanomas, cancers of the
Database Links

HGNC: 5465

OMIM: 147370

KEGG: hsa:3480

STRING: 9606.ENSP00000268035

UniGene: Hs.643120

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*