Recombinant Human Insulin-like growth factor 1 receptor(IGF1R),partial

Code CSB-EP011087HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names IGF1R
Uniprot No. P08069
Alternative Names CD221; CD221 antigen ; IGF 1 receptor; IGF 1R; IGF I receptor; IGF-I receptor; Igf1r; IGF1R_HUMAN; IGFIR; IGFIRC; IGFR; Insulin like growth factor 1 receptor; Insulin like growth factor 1 receptor precursor; Insulin-like growth factor 1 receptor beta chain; Insulin-like growth factor I receptor; JTK13; MGC142170; MGC142172; MGC18216; Soluble IGF1R variant 1; Soluble IGF1R variant 2
Species Homo sapiens (Human)
Source E.coli
Expression Region 763-931aa
Target Protein Sequence YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 46.4kDa
Protein Length Partial
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation, and tyrosines phosphorylation of multiple substrates, that function as signaling adapter proteins including, the insulin-receptor substrates (IRS1/2), Shc and 14-3-3 proteins. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways
Gene References into Functions
  1. MiR133a and miR133b may bind near rs1815009, and miR455 near rs2684788, within IGF1R 3'UTR. PMID: 30365147
  2. study confirms the utility of proximity-labeling methods, such as BioID, to screen for interactors of cell-surface receptors and has uncovered a role of one of these interactors, SNX6, in the IGF1R signaling cascade. PMID: 29530981
  3. Elevations of TGF-beta3, SMAD2 and SMAD4 in hypertrophic scars and increase of IGF-1R in immature stages may give some clues for acne hypertrophic scar formation. PMID: 30167815
  4. miR-30a-5p could influence chemo-resistance by targeting IGF1R gene in melanoma cells, which might provide a potential target for the therapy of chemo-resistant melanoma cells. PMID: 29642855
  5. IGF-1R signalling contributes to T cell dependent inflammation in arthritis. Inhibition of IGF-1R on the level of insulin receptor substrates alleviates arthritis by restricting IL6-dependent formation of Th17 cells and may open for new treatment strategies in rheumatoid arthritis. PMID: 28583713
  6. Novel G310D variant in the insulin-like growth factor 1 receptor gene is associated with type 2 diabetes. PMID: 29470850
  7. higher IGF-IR mRNA expression observed in obese children, associated with the higher IGF-I and ALS and the lower IGFBP-1 levels PMID: 29150385
  8. Study results revealed that microRNA-320a suppresses tumor cell growth and invasion of human breast cancer by targeting IGF-1R. PMID: 29989645
  9. miR539 may inhibit the aggressive behaviour of PDAC by directly targeting IGF1R and may serve as a novel therapeutic target for patients with this disease PMID: 29901181
  10. Data suggest that NEAT1, SRC3, and IGF1R are highly expressed in prostate cancer cells; NEAT1 appears to interact with SRC3 and promote cell proliferation via up-regulation of SRC3/IGF1R/AKT signaling pathway. (NEAT1 = nuclear paraspeckle assembly transcript-1; SRC3 = steroid receptor coactivator protein-3; IGF1R = insulin-like growth factor 1 receptor) PMID: 29225160
  11. Results showed that the expression of IGF1R appears to be highly correlated with the expression of ABCG2 in osteosarcoma and with the expression of CD44 in osteosarcoma patients under age of 10. PMID: 29892839
  12. Here the authors report a nodal role of IGF-IR in the regulation of ERalpha-positive breast cancer cell aggressiveness and the regulation of expression levels of several extracellular matrix molecules. PMID: 28079144
  13. Long noncoding RNA PVT1 enhances the expression of IGF1R through competitive binding to miR-30a. PMID: 29803929
  14. The association between the growth hormone-insulin-like growth factor-1 (GH-IGF-1) axis gene polymorphisms and short stature in Chinese children. PMID: 29687007
  15. High IGF1R expression is associated with non-small cell lung cancer. PMID: 29328495
  16. Our findings suggest that CKS1BP7 as well as IGF1R may serve as potential biomarkers for early detection and predict prognosis in breast cancer. PMID: 28439706
  17. High IGF-IR expression is associated with Ras and BRAF mutations in Hepatocellular Carcinoma. PMID: 28188432
  18. MicroRNA-381 inhibits cell proliferation and invasion in endometrial carcinoma by targeting the IGF-1R. PMID: 29257334
  19. IGF-1R and AKT inhibitors further increased apoptosis by Nutlin-3a in parental MHM cells and the cisplatin-resistant clones, confirming IGF-1R/AKT signaling promotes apoptosis resistance. PMID: 28696156
  20. autocrine IGF2 constitutively activated IGF1R and Akt phosphorylation, which was inhibited by BI 885578 treatment. BI 885578 significantly delayed the growth of IGF2-high colorectal cancer xenograft tumors in mice, while combination with a VEGF-A antibody increased efficacy and induced tumor regression. PMID: 28729397
  21. These findings demonstrated that hMSCCMmediated neuroprotection was attributed to IGF1Rmediated signaling, potentiated via the inhibition of IGF2 by IGFBP6. The results of the present study provide insight into the mechanism by which hMSC administration may promote recovery from nerve injury. PMID: 29039467
  22. loss of miR-99a in ESCC promoted the tumor cell proliferation, migration, invasion and slug-induced EMT through activating IGF1R signaling pathway. PMID: 28800315
  23. current data demonstrate that both INSR and IGF1R are directly targeted by C-myc and exert similar effects to promote the tumorigenesis and metastasis of TSCC through the NF-kappaB pathway. PMID: 29518496
  24. WP760 downregulated IGF1R. PMID: 28417283
  25. a cross-talk between IGF1R and Wnt/beta-catenin signaling pathways and showed, for the first time, that IGF1R is associated with upregulation of TCF-mediated beta-catenin transcriptional activity. PMID: 29621572
  26. MicroRNA-Dependent Regulation of IGF1R Gene Expression in Hormone-Sensitive and Hormone-Resistant Prostate Cancer Cells PMID: 29779108
  27. In contrast to preclinical studies that suggest a decrease in trastuzumab sensitivity in IGF1R(+) tumors, our adjuvant data show benefit of adding trastuzumab for patients with either IGF1R(+) and IGF1R(-) breast tumors. PMID: 28348046
  28. The findings demonstrate that miR-186 acts as a tumor suppressor by targeting IGF-1R in glioma. PMID: 28944896
  29. Forced expression of Klotho resulted in decline of activation of IGF-1R signaling, accompanied by decreased phosphorylation of its downstream targets, including AKT and ERK1/2. These data indicated that Klotho acts as a tumor suppressor via inhibiting IGF-1R signaling, thus suppressing the viability and promoting apoptosis in Tcell lymphoma. PMID: 28656297
  30. The study concluded that the expression modulation of tumor suppressors MIR-375 and MIR-145, and oncomiR MIR-224 have the ability to induce apoptosis of colorectal carcinoma cells through regulation of apoptosis mediating genes MTDH, MAP3K1, PDK1, BCL-XL and BAX. PMID: 28802228
  31. activation of the IGF-IR/PI3K/Akt signaling system is a common pattern in MLS which appears to be transcriptionally controlled, at least in part by induction of IGF2 gene transcription in a FUS-DDIT3-dependent manner. PMID: 28637688
  32. implantation of IGF1R(+) human dental pulp mesenchymal stem cells exerted enhanced neuroplasticity via integrating inputs from both CXCR4 and IGF1R signaling pathways. PMID: 27586516
  33. Study findings indicate that the T allele of IGF1R variant rs2016347 is associated with a significant reduction in breast cancer risk in women with a history of preeclampsia, most marked for HR+ breast cancer and in women with age at first birth less than 30. PMID: 28822014
  34. Study suggests that IGF-1R-AKT signalling imparts functional heterogeneity in cancer stem cells during acquirement of chemoresistance in ovarian carcinoma. PMID: 27819360
  35. IGF1R mRNA expression levels were reversely correlated with miR503 expression levels in breast tumors, suggesting that the upregulation of IGF1R may be due to downregulation of miR503 in breast cancer. PMID: 28656281
  36. miR-497 and miR-99a synergistically target IGF1R and mTOR, thereby impeding the HCC tumor growth. These results promote a concept in which not one single miRNA, but rather a network of miRNAs with shared and individual mRNA targets participates in the hepatocarcinogenesis. PMID: 28624790
  37. MiR379 acts as a tumor suppressor in NSCLC by directly targeting IGF1R. PMID: 28731178
  38. these results indicate that miR455 is involved in gastric cancer progression by directly targeting IGF1R and may serve as a novel therapeutic target for the treatment of gastric cancer. PMID: 28714005
  39. Tumor cells in CSF express IGF1R in High Risk, Metastatic Medulloblastoma. PMID: 27255663
  40. Insulin-like growth factor 1 receptor, associate of Myc 1, and peroxisome proliferator-activated receptor gamma coactivator 1beta are direct targets of miR-139 PMID: 26868851
  41. THADA fusion is a mechanism of IGF2BP3 activation and IGF1R signaling in thyroid cancer. PMID: 28193878
  42. In addition to conventional methods, IGF1R CNV can be identified from WES data. FACS analysis of live primary cells is a promising method for efficiently evaluating and screening for IGF1R haploinsufficiency. PMID: 28395282
  43. The T IGFR-1 genetic variant and a combination of the C VEGF-A and T IGFR-1 genetic variants increase the risk of developing Primary Open Angle Glaucoma. PMID: 28745651
  44. In endocrine-sensitive breast cancer cells, insulin was not growth stimulatory, likely due to the presence of hybrid InsR/IGF1R, which has high affinity for IGF-I, but not insulin. Combination inhibition of InsR and IGF1R showed complete suppression of the system in endocrine-sensitive breast cancer cells PMID: 28468775
  45. lower IGF-1R expression after teriparatide was associated with higher body fat, suggesting links between teriparatide resistance, body composition, and the GH/IGF-1 axis. PMID: 28218468
  46. Study showed that IGF-1 receptor (IGF-1R), which mediates survival pathways upon IGF binding, was highly expressed in oculomotor neurons and on extraocular muscle endplate. PMID: 27180807
  47. the present study confirmed the tumor suppressor function of miR-455 in melanoma, and demonstrated that miR-455 suppressed proliferation and invasion through directly targeting IGF-1R. PMID: 28440508
  48. IGF1R signaling under the given experimental conditions and NSCLC genetic background dictates the functional endpoint mechanism for TKI resistance. Manipulating this regulatory role of IGF1R can force the functional endpoint mechanism for TKI resistance in a defined and targetable direction here illustrated by the observed MET-amplification. PMID: 28418902
  49. Report complex relationships between individual tumor-specific expression of IGF1R/pIGF1R and InsR/pInsR, response endocrine treatment and breast cancer prognosis. PMID: 28030849
  50. These data imply the potential clinical application of EGF-LDP-IGF-AE for esophageal squamous cell carcinoma (ESCC)patients with EGFR and/or IGF-1R overexpression PMID: 28498434
  51. IGF-1R, a reported target of TMPRSS2-ERG (T2E) gene fusion, constitutes an independent factor for good prognosis in T2E-negative prostate cancer (PCa). Quantitative evaluation of IGF-1/IGF-1R expression combined with molecular assessment of T2E status or ERG protein expression represents a useful marker for tumor progression in localized PCa. PMID: 28545426
  52. Combining ER and IGF1R targeting with HER2 targeted therapies may be an alternative to HER2 targeted therapy and chemotherapy for patients with HER2/ER/IGF1R positive breast cancer. PMID: 28498399
  53. It is a key target gene of miR-193b. PMID: 28795385
  54. analysis of compounds that cause IGF-1Rbeta but not Insulin Receptor degradation specifically in tumor cells with no effects seen in normal diploid fibroblasts PMID: 27384680
  55. Results showed that IGF-1R mRNA was up-regulated in human hepatocellular carcinoma (HCC) tissues and cell lines. Its knockdown by RNAi led to apoptosis and decreased proliferation and invasion of HCC cells. PMID: 27813495
  56. ATM and Ataxia Telangiectasia and RAD3-related kinase have been identified as components of the DNA damage response (DDR) pathways as mediators of resistance to IGF-1R kinase inhibition in breast cancer cells PMID: 27472395
  57. A potential novel function of TMPRSS2-ERG as a major regulator of IGF1R gene expression. PMID: 27285981
  58. IGF-IR was shown to be a convergence point for the IGF-/EGF- and E2-dependent MCF-7 cell adhesion onto fibronectin. PMID: 27353258
  59. Data suggest that IGF-I/IGF-IR system triggers stimulatory actions through both GPER and DDR1 in aggressive tumors as mesothelioma and lung tumors. PMID: 27384677
  60. Results provide evidence that that IGF-1R is positively regulated by miR-1275. PMID: 29278769
  61. IGF1R phosphorylates histone H3 at tyrosine 41 and has a role in inducing SNAI2 expression in a process that involves Brg1 chromatin remodeling protein PMID: 27275536
  62. IGF2 gene overexpression in a series of children diagnosed with adrenocortical tumors was not related to any clinical or biological features analyzed here, while IGF1R gene expression was significantly higher in children who presented tumor relapse and metastasis, which was not true for the IGF1R protein expression analyzed by immunohistochemistry. IGF1R overexpression could be indicative of aggressive ACTs in children. PMID: 27185872
  63. Results show a significant over-expression of EGFR and IGF1R in adrenocortical carcinoma (ACC) tissue. PMID: 27105537
  64. Amla extract (Emblica officinalis, AE) decreases the gene and protein expression of IGF1R, a target of miR-375, and SNAIL1, a transcription factor that represses E-cadherin expression. PMID: 27129171
  65. GSK1904529A, a Potent IGF-IR Inhibitor, Reverses MRP1-Mediated Multidrug Resistance PMID: 28266043
  66. There is an accelerated loss of IGF1R, following loss of UBQLN1 in lung adenocarcinoma cells. PMID: 29054976
  67. data show that the GSK3B-FOXO3 pathway is activated after partial hepatectomy, and this may be one of the mechanisms that lead to upregulation of hepatic IGF1R after partial hepatectomy. PMID: 28952285
  68. The INSR purified in n-dodecyl-beta-D-maltoside showed ligand-stimulated autophosphorylation and kinase activity, suggesting an intact transmembrane signaling mechanism. PMID: 28830678
  69. Our findings suggest a novel mechanism by which CCE procyanidins can promote proteasome-independent degradation of nuclear Nrf2 through IGF-1R phosphorylation and cysteine protease activation. PMID: 29051069
  70. Data suggest that, as part of DNA repair in nucleus of embryonic stem cells, IGF1R interacts with and phosphorylates PCNA at tyrosine residues 60, 133, and 250; this is followed by mono- and polyubiquitination of PCNA by RAD18 and SHPRH. (IGF1R = insulin-like growth factor 1 receptor; PCNA = proliferating cell nuclear antigen; RAD18 = E3 ubiquitin-protein ligase RAD18; SHPRH = E3 ubiquitin-protein ligase SHPRH) PMID: 28924044
  71. These data suggest the involvement of IGF-2, IGF-1R, IGF-2R and PTEN in temporo-spatial patterning of basic cellular processes (proliferation, differentiation) during normal tooth development. PMID: 27326759
  72. Small interfering RNA-mediated IGF-1R knockdown mimics the effects of miR-375 up-regulation, while overexpression of Insulin Like Growth Factor 1 Receptor partially reverses those effects in oral squamous cell carcinoma cells. PMID: 28810236
  73. miR-30a suppressed migration and invasion through the IGF1R/p-AKT/b-catenin/E-cadherin pathway in colorectal cancer cells. PMID: 28932920
  74. Results detected IGF1R gene amplification and that it was correlated with high levels of mRNA and protein expression in type IV gastric neoplasm. PMID: 27891760
  75. Signaling via the insulin (INS) and insulin-like growth factor 1 (IGF1) receptors (INSR and IGF1R) regulate basal cell (BC) differentiation into ciliated cells. PMID: 28050756
  76. Ultravioet rays-induced DNA repair in geriatric keratinocytes is due in part to silenced IGF-1R activation. PMID: 27373487
  77. demonstrate for the first time exosomal enrichment of G-protein-coupled receptor kinase (GRK) 5 and GRK6, both of which regulate Src and IGF-IR signaling and have been implicated in cancer. PMID: 27232975
  78. This meta-analysis revealed that high expression of IGF-1R was associated with poor prognosis in non-small cell lung cancer. PMID: 28946136
  79. The present study was aimed at evaluating the hypothesis that nuclear IGF1R localization is not restricted to cancer cells and might constitute a novel physiologically relevant regulatory mechanism. Our data shows that nuclear translocation takes place in a wide array of cells, including normal diploid fibroblasts. PMID: 28945762
  80. MicroRNA-302b-3p suppresses cell proliferation through AKT pathway by targeting IGF-1R in human gastric cancer. PMID: 28743112
  81. This study reveals contrasting abilities of IGF-1R to interact with each b-arrestin isoform, depending on the presence of the ligand and demonstrates the antagonism between the two b-arrestin isoforms in controlling IGF-1R expression and function, which could be developed into a practical anti-IGF-1R strategy for cancer therapy. PMID: 28581517
  82. Our results indicated that miR-100 could exert tumor suppression function by inhibiting PI3K/AKT and MAPK/ERK signaling pathways via targeting IGFIR PMID: 26306402
  83. miR-223/IGF-IR signalling pathway is regulated in parallel in both the lung vasculature and the right ventricle under conditions of hypoxia induced pulmonary hypertension. PMID: 27013635
  84. Results provide a mechanistic understanding for the observation that loss of IGF-1R expression decreases tamoxifen sensitivity resulting from reduced FoxO1 expression in breast cancer cells. PMID: 28096479
  85. IGF2 also requires integrin binding for signaling functions, and the IGF2 mutants that cannot bind to integrins act as antagonists of IGF1R. PMID: 28873464
  86. Results provide evidence that uPA and IGF1R directly interact with uPAR enhancing malignant potential of triple-negative breast cancer. PMID: 27502396
  87. High IGF1R expression is associated with skin melanoma. PMID: 28092675
  88. Low IGF1R expression is associated with low bone mineral density in patients with type 1 diabetes. PMID: 26663878
  89. GRK2 is negatively related to IGF1R and IGF1R, but not GRK2, was associated with the tumour-node-metastasis stage and overall and disease-free survival in hepatocellular carcinoma. PMID: 28202495
  90. Heterodimerization of EGFR with IGF-1R can lead to increased activity of EGFR and may be an important platform for cetuximab mediated signaling in head and neck tumors that have become resistant to anti-EGFR therapy. PMID: 27716204
  91. mTORC1/2 inhibition promotes reorganization of integrin/focal adhesion kinase-mediated adhesomes, induction of IGFR/IR-dependent PI3K activation, and Akt phosphorylation via an integrin/FAK/IGF1R-dependent process, mediating tumor drug resistance. PMID: 28757207
  92. Data show that the let-7c/miR-99a/miR-125b cluster controlled tumorigenesis by targeting IL-6, IL-6R and IGF1R. PMID: 26455324
  93. IGF1R expression may have prognostic relevance in penile squamous cell carcinoma PMID: 28349238
  94. High IGF1R expression is associated with bone metastasis in prostate cancer. PMID: 28447314
  95. the Runx2 knockdown cells displayed activation of AMP-activated protein kinase (AMPKalpha), the sensor of cellular metabolism. Importantly, the Runx2 knockdown in bone-derived cells resulted in increased sensitivity to both Erk1/2 inhibition and AMPKalpha activation by PD184161 and metformin, respectively, despite increased IGF-1Rbeta and AMPKalpha levels. PMID: 26804175
  96. Overexpression of mutated K-RAS in gastrointestinal cancer cell lines led to more aggressive phenotypes, with increased proliferation, decreased apoptosis, and increased motility and invasion. IGF-1R blockade suppressed cell growth, colony formation, migration, and invasion, and up-regulated chemotherapy-induced apoptosis of gastrointestinal cancer cells, even when mutated K-RAS was over-expressed. PMID: 27312358
  97. The authors found low levels of IGF1R expression and PTEN-negative status to correlate with resistance to IGF1R inhibition as a treatment for Human T-Cell Acute Lymphoblastic Leukemias. PMID: 27532210
  98. miR-15b inhibits the progression of glioblastoma cells through targeting IGF1R, and miR-15b can be recommended as a tumor suppressor in the progression of glioblastoma. PMID: 27896672
  99. our findings suggested that miR-205 serves as a prognostic factor and suppresses proliferation and invasion by targeting insulin-like growth factor receptor 1 in human cervical cancer. Thus, miR-205/insulin-like growth factor receptor 1 pathway may be of great benefit to cervical cancer patients PMID: 28651495
  100. Quantification of IGF-1 Receptor May Be Useful in Diagnosing Polycythemia Vera PMID: 27812134

Show More

Hide All

Involvement in disease Insulin-like growth factor 1 resistance (IGF1RES)
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Protein kinase superfamily, Tyr protein kinase family, Insulin receptor subfamily
Tissue Specificity Found as a hybrid receptor with INSR in muscle, heart, kidney, adipose tissue, skeletal muscle, hepatoma, fibroblasts, spleen and placenta (at protein level). Expressed in a variety of tissues. Overexpressed in tumors, including melanomas, cancers of the
Database Links

HGNC: 5465

OMIM: 147370

KEGG: hsa:3480

STRING: 9606.ENSP00000268035

UniGene: Hs.643120

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1