Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-MP011087HU |
| Product Type | Recombinant Protein |
| Size | US$1232 |
| Uniprot No. | P08069 |
| Relevance | Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation, and tyrosines phosphorylation of multiple substrates, that function as signaling adapter proteins including, the insulin-receptor substrates (IRS1/2), Shc and 14-3-3 proteins. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways: the PI3K-AKT/PKB pathway and the Ras-MAPK pathway. The result of activating the MAPK pathway is increased cellular proliferation, whereas activating the PI3K pathway inhibits apoptosis and stimulates protein synthesis. Phosphorylated IRS1 can activate the 85 kDa regulatory subunit of PI3K (PIK3R1), leading to activation of several downstream substrates, including protein AKT/PKB. AKT phosphorylation, in turn, enhances protein synthesis through mTOR activation and triggers the antiapoptotic effects of IGFIR through phosphorylation and inactivation of BAD. In parallel to PI3K-driven signaling, recruitment of Grb2/SOS by phosphorylated IRS1 or Shc leads to recruitment of Ras and activation of the ras-MAPK pathway. In addition to these two main signaling pathways IGF1R signals also through the Janus kinase/signal transducer and activator of transcription pathway (JAK/STAT). Phosphorylation of JAK proteins can lead to phosphorylation/activation of signal transducers and activators of transcription (STAT) proteins. In particular activation of STAT3, may be essential for the transforming activity of IGF1R. The JAK/STAT pathway activates gene transcription and may be responsible for the transforming activity. JNK kinases can also be activated by the IGF1R. IGF1 exerts inhibiting activities on JNK activation via phosphorylation and inhibition of MAP3K5/ASK1, which is able to directly associate with the IGF1R. When present in a hybrid receptor with INSR, binds IGF1. PubMed:12138094 shows that hybrid receptors composed of IGF1R and INSR isoform Long are activated with a high affinity by IGF1, with low affinity by IGF2 and not significantly activated by insulin, and that hybrid receptors composed of IGF1R and INSR isoform Short are activated by IGF1, IGF2 and insulin. In contrast, PubMed:16831875 shows that hybrid receptors composed of IGF1R and INSR isoform Long and hybrid receptors composed of IGF1R and INSR isoform Short have similar binding characteristics, both bind IGF1 and have a low affinity for insulin. |
| Image |
|
| Storage Buffer | Tris-based buffer，50% glycerol |
| Species | Homo sapiens (Human) |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Sequence | YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE |
| Research Area | Developmental Biology |
| Source | Mammalian cell |
| Gene Names | IGF1R |
| Protein Names | Insulin-like growth factor I receptor Short name: IGF-I receptor |
| Expression Region | 763-931aa |
| Tag Info | N-terminal 10xHis-tagged |
| Mol. Weight | 21.9 kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation, and tyrosines phosphorylation of multiple substrates, that function as signaling adapter proteins including, the insulin-receptor substrates (IRS1/2), Shc and 14-3-3 proteins. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways |
| Involvement in disease | Insulin-like growth factor 1 resistance (IGF1RES) |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein |
| Protein Families | Protein kinase superfamily, Tyr protein kinase family, Insulin receptor subfamily |
| Tissue Specificity | Found as a hybrid receptor with INSR in muscle, heart, kidney, adipose tissue, skeletal muscle, hepatoma, fibroblasts, spleen and placenta (at protein level). Expressed in a variety of tissues. Overexpressed in tumors, including melanomas, cancers of the |
| Database Links |
HGNC: 5465 OMIM: 147370 KEGG: hsa:3480 STRING: 9606.ENSP00000268035 UniGene: Hs.643120 |
| Pathway |
HIF-1 signaling pathway
MAPK signaling pathway mTOR signaling pathway PI3K-Akt signaling pathway Focal adhesion Adherens junction Autophagy Ras signaling pathway Signaling pathways regulating pluripotency of stem cells AMPK signaling FoxO signaling pathway Rap1 signaling pathway Endocytosis |
IGF1R Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA011087GA01HU | IGF1R Antibody | Human,Mouse,Rat | ELISA,WB,IP |
| CSB-PA597654 | Phospho-IGF1R (Tyr1165/Tyr1166) Antibody | Human,Mouse,Rat | ELISA,WB,IF |
| CSB-PA067618 | IGF1R (Ab-1161) Antibody | Human,Mouse,Rat | ELISA,WB,IHC,IF |
| CSB-PA142373 | IGF1R (Ab-1165/1166) Antibody | Human,Mouse,Rat | ELISA,WB |
| CSB-PA120059 | Phospho-IGF1R (Tyr1161) Antibody | Human,Mouse,Rat | ELISA,WB,IHC,IF |
| CSB-PA945418 | Phospho-IGF1R (Tyr1346) Antibody | Human,Mouse,Rat | ELISA,IHC |
| CSB-PA942675 | IGF1R (Ab-1346) Antibody | Human,Mouse | ELISA,WB,IHC |
| CSB-PA443662 | IGF1R (Ab-1280) Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-PA449888 | Phospho-IGF1R (Tyr1280) Antibody | Human | ELISA,WB |
| CSB-PA277594 | IGF1R (Ab-1346) Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-PA000549 | Phospho-IGF1R (Y1165/Y1166) Antibody | Human,Mouse,Rat,Monkey | WB,ELISA |
| CSB-PA009487 | Phospho-IGF1R (Y1346) Antibody | Human,Mouse,Rat | IHC,ELISA |
| CSB-PA009489 | IGF1R Antibody | Human,Mouse,Rat | WB,ELISA |
| CSB-PA009490 | IGF1R Antibody | Human,Mouse,Rat | WB,IHC,ELISA |
| CSB-PA08395B0Rb | IGF1R Antibody, HRP conjugated | Human | ELISA |
| CSB-PA08395C0Rb | IGF1R Antibody, FITC conjugated | Human | ELISA |
| CSB-PA08395D0Rb | IGF1R Antibody, Biotin conjugated | Human | ELISA |
IGF1R Antibodies for
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA009488 | IGF1R Antibody | Human,Mouse,Rat | WB,ELISA |
IGF1R Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA08395A0Rb | IGF1R Antibody | Human | ELISA, IF |
IGF1R Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP011087HU | Recombinant Human Insulin-like growth factor 1 receptor(IGF1R),partial | E.coli |
| CSB-YP011087HU | Recombinant Human Insulin-like growth factor 1 receptor(IGF1R),partial | Yeast |
| CSB-CF011087HU | Recombinant Human Insulin-like growth factor 1 receptor(IGF1R) | in vitro E.coli expression system |
| CSB-EP011087HUa0 | Recombinant Human Insulin-like growth factor 1 receptor(IGF1R),partial | E.coli |
| CSB-BP011087HU |
Recombinant Human Insulin-like growth factor 1 receptor(IGF1R),partial | Baculovirus |
IGF1R ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E13766h | Human insulin-like growth factors 1 receptor,IGF-1R ELISA Kit | serum, plasma, tissue homogenates | 0.078 ng/mL |
Recombinant Human Phospholipase A2, membrane associated(PLA2G2A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human ATP synthase subunit alpha, mitochondrial(ATP5F1A)
Express system: E.coli
Species: Homo sapiens (Human)
