Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Developmental Biology
Alternative Names
CD221; CD221 antigen ; IGF 1 receptor; IGF 1R; IGF I receptor; IGF-I receptor; Igf1r; IGF1R_HUMAN; IGFIR; IGFIRC; IGFR; Insulin like growth factor 1 receptor; Insulin like growth factor 1 receptor precursor; Insulin-like growth factor 1 receptor beta chain; Insulin-like growth factor I receptor; JTK13; MGC142170; MGC142172; MGC18216; Soluble IGF1R variant 1; Soluble IGF1R variant 2
Species
Homo sapiens (Human)
Expression Region
763-931aa
Target Protein Sequence
YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Advance your research in developmental biology with our high-quality Recombinant Human IGF1R protein, an essential tyrosine kinase receptor involved in the regulation of cell growth, differentiation, and metabolism. As the receptor for insulin-like growth factor 1 (IGF-1), it is pivotal in the mediation of IGF-1 signaling and has been associated with numerous physiological processes and pathological conditions, including cancer and diabetes.
Our Recombinant Human IGF1R protein encompasses a partial protein sequence (763-931 amino acids) and is expressed in mammalian cell systems, ensuring proper folding and post-translational modifications. The N-terminal 10xHis-tag enables efficient protein purification and detection, while its purity, greater than 85% as determined by SDS-PAGE, ensures accurate and reproducible results in your experiments. Available in both liquid and lyophilized powder forms, our Recombinant Human IGF1R protein is adaptable to meet the demands of your research endeavors.
