Recombinant Human Interleukin-1 beta protein (IL1B),Partial

In Stock Promotion
Code CSB-EP011614HUa0
MSDS
Size
Order now
Promotion
Promotional price as low as $99
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
IL1B
Uniprot No.
Research Area
Immunology
Alternative Names
(IL-1 beta)(Catabolin)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
117-269aa
Target Protein Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
21.5 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6.
Gene References into Functions
  1. a genome wide association study for "high" gingival crevicular fluid IL-1beta expression among 4910 European-American adults and identify association signals in the IL37 locus, is reported. PMID: 30206230
  2. Treatment with 30 microg/ml curcumin significantly down-regulated mRNA expression of IL-1beta (p < .05) and protein production of IL-6 (p < .05) in M1 macrophages from Behcet's disease patients but not in M1 macrophage from controls. PMID: 29806793
  3. pp65 mediates human cytomegalovirus immune evasion through downmodulation of IL-1beta. PMID: 30332797
  4. The children in the acute phase of Kawasaki disease had a significantly higher level of IL-1beta than the healthy control group . PMID: 30022755
  5. circSEMA4B serves as a miR-431 sponge to compete with SFRP1 or GSK-3beta for miR-431 binding, thus inhibiting IL-1beta-induced nucleus pulposus degenerative process in intervertebral disc degeneration. PMID: 30251693
  6. IL-1beta-511TT genotype may influence the development of antiretroviral-associated hepatotoxicity and its severity in alcohol and nevirapine users independently and in combination. PMID: 29849489
  7. Impairment in TNF, IL-1beta, and IL-17 production upon stimulation with mycobacterial antigens may contribute to the increased susceptibility to M. tuberculosis infection observed in HTLV-1 infected individuals. PMID: 29523325
  8. rs16944 minor A allele less frequent in type-2 diabetes mellitus PMID: 28634744
  9. This study demonstrated significant differences in the blood levels of IL-1 beta between people with epilepsy and healthy subjects. PMID: 30140987
  10. Polymorphisms of IL-1betab and TNF-a are not a risk of ICC, but an individual with O. viverrini infection has an effect on all genotypes of the TNF-alpha gene that might promote intrahepatic cholangiocarcinoma . Primary prevention of intrahepatic cholangiocarcinoma in high-risk areas is based on efforts to reduce O. viverrini infection. PMID: 30139338
  11. Melatonin inhibits epithelialtomesenchymal transition in gastric cancer cells via attenuation of IL1beta/NFkappaB/MMP2/MMP9 signaling. PMID: 30066836
  12. Study findings suggest that both promoter and exon polymorphisms of IL-1B gene have a significant role in the risk of developing Graves' disease (GD), whereas IL-1RN-VNTR variant has no association with GD in North India Kashmiri population. PMID: 29454070
  13. The IL-6 expression was consistently associated with necrotizing fasciiitis severity, whereas IL1B had the strongest association with 30-day mortality. PMID: 28176831
  14. Taken together, the silencing of H4R inhibited the H4R mediated Mast cell functions and SAPK/JNK phosphorylation. Furthermore, the H4R activation utilized SAPK/JNK signaling pathway for IL-1beta release in HMC-1 cells PMID: 29863427
  15. IL-1beta/IL-6 network is highly expressed in the colorectal cancer (CRC) microenvironment, indicating that this network is important in the progression of CRC PMID: 29803656
  16. Colombian individuals with high African ancestry proportions at locus 2q14 harbour more IL1B-CGTC copies and are consequently at an increased risk of colorectal cancer. PMID: 28157220
  17. Study found a statistically significant association between the IL-1B rs16944 polymorphism and febrile seizures (FS) risk in Caucasians and Asians. The TT+CT genotypes were associated with a 1.43 times increased risk for FS in Caucasians, while an increased risk of 1.39 times was observed for FS development for the TT homozygotes in Asians. PMID: 29808330
  18. Preincubation of LAD2 cells with the natural flavonoid methoxyluteolin (1-100 mM) inhibits (P < 0.0001) secretion and gene expression of IL-1beta, procaspase-1, and pro-IL-1beta. Mast cell secretion of IL-1beta in response to SP and IL-33 reveals targets for the development of antiinflammatory therapies. PMID: 30232261
  19. in Caco-2 CFTR-shRNA cells, the EGFR ligand EREG is overexpressed due to an active IL-1beta autocrine loop that indirectly activates EGFR, constituting new signaling effectors for the CFTR signaling pathway, downstream of CFTR, Cl(-) , and IL-1beta. PMID: 29091309
  20. Caspase-1-dependent IL-1beta processing and secretion require the AIM2 inflammasome pathway in human dental pulp cells and the AIM2 inflammasome pathway is critical for regulation of the dental pulp immune response. PMID: 29178062
  21. Genetic Polymorphisms of IL1B, IL6, and TNFalpha in a Chinese Han Population with Pulmonary Tuberculosis. PMID: 29888256
  22. Our results demonstrate that in the early stage of sepsis, JMJD3 contributes to high levels of neutrophil mPR3 expression and thereby to the production of the inflammatory cytokine IL-1beta PMID: 29621735
  23. In the current study, we found a clear inflammagenesis gene signature in COPD small airway epithelium, with increased gene expression of CCL2, CCL7, IL1B and IL1R2 in lung small airway epithelial cells. We provide evidence for IL1B as a novel player in inflammation. PMID: 29616282
  24. The results of this study suggested that rs16944 of IL-1 beta may act as a risk factor for multiple system atrophy. PMID: 29251119
  25. IL-1 role in cardiovascular diseases [review] PMID: 29549570
  26. Sendai Virus V Protein Inhibits the Secretion of Interleukin-1beta by Preventing NLRP3 Inflammasome Assembly. PMID: 30021903
  27. This study suggested that -511 C/T (rs16944) and -31 C/T (rs1143627) polymorphisms in IL-1beta gene may not be involved in RPL in Iranian Azeri women. Also the promoter polymorphism of the IL-1RN gene may not play a role in the susceptibility to RPL. PMID: 29281611
  28. IL-1beta and CTHRC1 are upregulated in patients with Osteoarthritis. PMID: 29393342
  29. our observations indicated that IL-1beta-mediated NF-kappaB signaling augments the osteosarcoma cell growth via modulating MiR-376c/TGFA axis PMID: 29441940
  30. Insulin resistance correlates positively with IL-1beta among non-diabetic hemodialysis patients. PMID: 29436520
  31. The baseline concentrations of IL-6 and IL-1beta were significantly higher in the Major Depressive Disorder group than those in the control group. There was no significant difference of TNF-alpha between the two groups. PMID: 29587166
  32. The genetic association between the studied SNPs of the IL-1beta gene and recurrent apththous stomatitis remains controversial and requires further investigation. PMID: 28942153
  33. The rs16944 TT genotype of Il-1 beta is associated with mesial temporal lobe epilepsy with hippocampal sclerosis development what may be explained by the higher IL-1beta levels produced by this genotype. PMID: 28675059
  34. Our meta-analysis proved that IL-1beta + 3954C/T is associated with MI susceptibility, especially among Caucasian populations. PMID: 30045312
  35. In this longitudinally monitored male population, observed effect of baseline central adiposity on future periodontitis progression is conditional on proinflammatory IL-1 genetic variations. PMID: 27541081
  36. In Pakistani population, an increased risk of gastric cancer development is associated with the carriage of IL-1B-511*T and IL-1RN*2 alleles PMID: 28110439
  37. This study revealed that the P2X7R/NLRP3 pathway plays important roles in IL-1beta secretion and inhibition of Toxoplasma gondii proliferation in small intestinal epithelial cells. PMID: 29291748
  38. These results indicate that tumorderived IL1beta enhanced stromal glycolysis and induced oneway lactate flow from the tumor mesenchyme to transformed epithelium, which promotes oral squamous cell carcinoma cell proliferation PMID: 29207019
  39. Therefore, the common allergen Der f1 was not only found to induce allergy, but also led to pyroptosis and IL1beta secretion via the NLRP3caspase1 inflammasome in human bronchial epithelial cells PMID: 29207030
  40. Increased production of IL-1beta in the gut-associated lymphoid tissue and peripheral blood of HIV infected patients. PMID: 29672590
  41. IL-1beta is involved in the regulation of OPN levels during respiratory syncytial virus infection. PMID: 29677209
  42. Sequencing results of samples from different individuals discovered that polymorphisms on the loci 154 and 486 significantly increased the risks of obstructive sleep apnea syndrome and affected IL-1beta protein expression. However, we did not conduct in-depth research PMID: 28742193
  43. sauchinone inhibited inflammatory response in IL-1beta-stimulated human chondrocytes probably through inhibiting the activation of NF-kappaB signaling pathway. These data suggest that sauchinone may be a potential agent in the treatment of OA. PMID: 29356224
  44. VPS4B might facilitate chondrocyte apoptosis in Osteoarthritis via p38 MAPK signaling pathway. PMID: 28744712
  45. this study shows that IL-1beta limits the level of NK cell activation by inducing apoptosis and suppression as a homeostatic regulatory function PMID: 27086951
  46. Higher IL-1beta levels are associated with post-stroke depression at 2 weeks in the presence of the -511T allele with a borderline significant interaction term and with any +3953C/T polymorphism without a significant interaction term. PMID: 28844626
  47. In multivariate analysis, the IL1B rs16944 TT and TNF rs1799964 TC genotypes were significantly associated with intrauterine cytomegalovirus infection. Twenty-two out of 72 congenitally infected newborns had confirmed sensorineural hearing loss. Carriers of CT or TT genotype of CCL2 rs13900 had increased risk of hearing loss at birth and at 6 months of age. PMID: 28501927
  48. TNFalpha and IL-1beta mediated expression of E-selectin preferentially attract sialyl Lewis(X) mediated mucosal-associated invariant T cell migration into the synovial fluid of rheumatoid arthritis patients. PMID: 28756336
  49. These data indicate a process of NF-kappaB-induced miR-506 suppression and JAG1 upregulation upon IL-1beta induction. PMID: 28926924
  50. Effective IL1beta and CCL2 antagonists are currently in clinical review to treat benign inflammatory disease, and their transition to the cancer clinic could have a rapid impact PMID: 28790030

Show More

Hide All

Subcellular Location
Cytoplasm, cytosol. Lysosome. Secreted, extracellular exosome. Secreted.
Protein Families
IL-1 family
Tissue Specificity
Expressed in activated monocytes/macrophages (at protein level).
Database Links

HGNC: 5992

OMIM: 147720

KEGG: hsa:3553

STRING: 9606.ENSP00000263341

UniGene: Hs.126256

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*