Recombinant Human Interleukin-1 beta(IL1B)

In Stock
Code CSB-EP011614HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P01584
Relevance Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP011614HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL1B.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP011614HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL1B.
Storage Buffer Tris-based buffer,50% glycerol
Alias Catabolin
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Research Area Immunology
Source E.coli
Gene Names IL1B
Protein Names Recommended name: Interleukin-1 beta Short name= IL-1 beta Alternative name(s): Catabolin
Expression Region 117-269aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 33.4kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells.
Subcellular Location Cytoplasm, cytosol, Lysosome, Secreted, exosome, Secreted
Protein Families IL-1 family
Tissue Specificity Expressed in activated monocytes/macrophages (at protein level).
Database Links

HGNC: 5992

OMIM: 147720

KEGG: hsa:3553

STRING: 9606.ENSP00000263341

UniGene: Hs.126256

Pathway MAPK signaling pathway
Lipids and Inflammation in Atherogenesis
NF-kappa B signaling pathway
TNF signaling pathway
Necroptosis
Hematopoietic cell lineage
IL-17 signaling pathway
Inflammasome Signaling
NOD-like receptor signaling pathway
Osteoclast differentiation
Th17 cell differentiation
Toll-like receptor signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Excitatory synapse pathway

Related Products

IL1B Antibodies

IL1B Antibodies for Homo sapiens (Human)

IL1B Proteins

IL1B Proteins for Homo sapiens (Human)

IL1B ELISA Kit

IL1B ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.