Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-EP011614HU |
| Size | $1812 |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
The gene fragment corresponding to the 117-269aa of the human IL1B protein was synthesized, with appropriate restriction sites suitable for in-frame cloning into an expression vector, with N-terminal 6xHis-SUMO tag. The E.coli was transformed with the expression vector, and the clone was expressed upon certain induction. After the induced cell centrifugation, the recombinant protein was purified from the cell extract and presented as N-terminal 6xHis-SUMO-tagged fusion. Its purity is greater than 90% assayed by SDS-PAGE. The IL1B protein ran to a band of about 33 kDa molecular weight on the gel. Interleukin 1beta is a proinflammatory cytokine encoded by the IL1B gene located on chromosome 2. Interleukin levels are normally low in the CNS but are elevated after acute injury and in chronic neurodegenerative diseases such as Alzheimer's disease (AD). IL1 gene variants should be considered disease modifiers in RA. Some researches found that he rare allele of the IL-1B is associated with the destructive pattern characteristic of chronic RA. The pro-inflammatory cytokine IL-1 is produced by the inflammatory synovium and appears to play a predominant role in the destructive pattern associated with RA. It is a known activator of collagenase and stromelysin and inhibits the synthesis of collagen and proteoglycan. In addition, p62-induced autophagic degradation of caspase-1 accounted for caspase-1/IL1B inactivation in CD44s deficient cells. Many findings implied that IL1B polymorphisms modulate cystic fibrosis lung disease. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | IL1B |
| Uniprot No. | P01584 |
| Research Area | Immunology |
| Alternative Names |
Catabolin; H1; IFN beta inducing factor; IL 1; IL 1 beta; IL-1 beta; IL1; IL1 BETA; IL1B; IL1B_HUMAN; IL1F2; Interleukin 1 beta; Interleukin 1 beta precursor; interleukin 1; beta; Interleukin-1 beta; OAF; Osteoclast activating factor; OTTHUMP00000162031; Preinterleukin 1 beta; Preinterleukin beta; Pro interleukin 1 beta
|
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 117-269aa |
| Target Protein Sequence | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 33.4kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info |
N-terminal 6xHis-SUMO-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6.
|
| Gene References into Functions |
|
| Subcellular Location | Cytoplasm, cytosol. Lysosome. Secreted, extracellular exosome. Secreted. |
| Protein Families | IL-1 family |
| Tissue Specificity | Expressed in activated monocytes/macrophages (at protein level). |
| Database Links |
HGNC: 5992 OMIM: 147720 KEGG: hsa:3553 STRING: 9606.ENSP00000263341 UniGene: Hs.126256 |
