Recombinant Human Interleukin-3 (IL3) (Active)

In Stock
Code CSB-AP004531HU
Abbreviation Recombinant Human IL3 protein (Active)
MSDS
Size $204
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
①Loaded Human IL-3RA-Fc on Protein A Biosensor, can bind Human IL-3 with an affinity constant of 3.89uM as determined in BLI assay. ②Loaded Human IL-3RA-Fc-Avi on Protein A Biosensor, can bind Human IL-3 with an affinity constant of 3.74 uM as determined in BLI assay.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Colony stimulating factor multiple; Hematopoietic growth factor; IL 3; IL-3; IL3; IL3_HUMAN; Interleukin 3 (colony stimulating factor; multiple); Interleukin 3; Interleukin-3; Mast cell growth factor; MCGF; MGC79398; MGC79399; Multi CSF; Multilineage colony stimulating factor; Multipotential colony stimulating factor; Multipotential colony-stimulating factor; OTTHUMP00000065963; P cell stimulating factor ; P-cell-stimulating factor
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
20-152aa
Complete Sequence
APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Mol. Weight
16.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20mMPB,5%Sucrose,0.05%Tween80,pH 6.5.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Interleukin-3 is a pleiotropic cytokine that drives the proliferation and differentiation of multipotent hematopoietic progenitors, making it essential for studying early myeloid and mast cell lineage commitment. This recombinant human IL-3 encompasses the full mature sequence (aa 20–152) expressed in *E. coli* with an N-terminal 6xHis tag, and BLI assays confirm binding to human IL-3RA-Fc with a KD of approximately 3.74–3.89 µM, validating receptor engagement suitable for JAK/STAT signaling pathway studies and TF-1 cell proliferation assays. Endotoxin levels below 1.0 EU/µg minimize LPS-driven artifacts in sensitive immune cell functional assays, supporting use in hematopoietic differentiation experiments, antibody development workflows, and as a reference standard in cytokine detection platforms such as ELISA. Purity exceeding 95% by SDS-PAGE, combined with this stringent endotoxin control, satisfies the quality criteria typical for cell-based activation and proliferation studies where cytokine-specific effects must be clearly distinguished from contaminant-driven responses.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
Gene References into Functions
  1. IL-3 may be involved in the immediate memory deficits in the chronic phase of schizophrenia. PMID: 29554544
  2. The present study demonstrates for the first time that IL-3 has an important role in enhancing the migration of human MSCs through regulation of the CXCR4/SDF-1alpha axis. These findings suggest a potential role of IL-3 in improving the efficacy of MSCs in regenerative cell therapy. PMID: 28705238
  3. These results indicate that IL-3 regulates endothelial cells-extracellular vesicles release, cargo and IL-3 angiogenic paracrine action via STAT5. PMID: 27157262
  4. T-GM-CSF and -IL-3 significantly, and reciprocally, blunted receptor binding and myeloid progenitor cell proliferation activity of both FL-GM-CSF and -IL-3 in vitro and in vivo PMID: 28344320
  5. Results show that IL-3 induces several signaling pathways associated with increased cell survival under oxidative stress. This activity correlates with previous fi ndings indicating glucose uptake stimulation by IL-3, which together contribute to an emerging picture of a broader mechanism promoting cell survival. PMID: 27862234
  6. The IL-3/ GM-CSF effected on the myofibroblastic differentiation of human adipose derive stromal cells (hASCs) as well as it did on human dermal fibroblasts (HDFs). PMID: 28377320
  7. Genetically engineered mesenchymal stromal cells produce IL-3 and TPO to further improve human scaffold-based xenograft models PMID: 28456746
  8. IL-3 hardly down-regulates the alpha-chain of its receptor without depleting the common beta-chain, which enables extraordinarily sustained signaling events, predominantly the activation of Stat5. PMID: 27443880
  9. genetic polymorphisms in the immune genes IL-3 rs181781 and CTLA4 rs4553808 may influence the TAC dose-adjusted concentrations PMID: 28112181
  10. Our results indicated that the IL-3 and IL-13 polymorphisms were not associated with rheumatoid arthritis (RA). stratification analyses suggested that the IL-13 rs1800925 CT and CT/CC genotypes increased the risk of RA in patients with erythrocyte sedimentation rate (ESR) <25.00. these findings suggest that the IL-13 rs1800925 C/T polymorphism may be associated with increased risk of RA in ESR PMID: 27323078
  11. results suggest that IL-3 and IL-12p40 could be considered as molecular predictors for recurrent wheezing due to RSV infection PMID: 26299549
  12. results suggest that IL3 is an important genetic regulator for human brain volume variation and implied that IL3 might have experienced weak or modest positive selection in the evolutionary history of humans PMID: 26875095
  13. Thymic stromal lymphopoietin activation of basophils in patients with allergic asthma is IL-3 dependent PMID: 25962901
  14. were not able to confirm the association of IL-3 SNPs with schizophrenia. PMID: 26277822
  15. findings showed that high plasma IL-3 levels are associated with high mortality in sepsis PMID: 25766237
  16. Genetic variation in interleukin-3 gene is associated with breast cancer risk. PMID: 24670917
  17. results suggest that HuR recognizes the ARE-rich region in the IL-3 3'-UTR and plays a role in the IL-3 3'-UTR-mediated post-transcriptional control in T-cells PMID: 24658545
  18. A single nucleotide polymorphism (SNP; rs20541) in the IL-13 gene has been recognized as a risk factor for asthma. PMID: 23978640
  19. This study is the first to link beta-catenin activation to IL-3 and suggests that targeting IL-3 signaling may be an effective approach for the inhibition of beta-catenin activity in some patients with AML. PMID: 24598054
  20. IL3 SNP rs40401 is significantly associated with the risk of asthma in young adult Japanese women. PMID: 24684517
  21. This is the first study to show a significant positive association between IL3 SNP rs40401 variant and the risk of rhinoconjunctivitis. PMID: 23953855
  22. IL3 rs2073506 G>A polymorphism is associated with an increased risk for esophageal cancer of nodal and metastatic stages. PMID: 23726808
  23. Genetic variation in the IL3 promoter affects human brain volume by regulating proliferation and survival of neural progenitors. PMID: 23226269
  24. Transgenic mice are used to study the developmental regulation of the closely linked IL-3 and granulocyte-macrophage colony stimulting factor (GM-CSF) locus and to identify DNA enhancer elements required for its correct activity in vivo. PMID: 23024272
  25. data indicate that within microenvironments rich in betac-family cytokines and TNF, eosinophils are a source of proMMP-9 and highlight a previously unrecognized role for synergistic interaction between TNF and betac-family cytokinea, for proMMP-9 synthesis PMID: 22321809
  26. This study demonistrated that Carriers of the minor allele for a single nucleotide polymorphism in IL13 (rs1295686) were more likely to report breast pain prior to surgery (P = .019). PMID: 22515947
  27. an IL-3 autocrine loop can drive a tumor endothelial switch and that targeting IL-3 might confer a significant therapeutic advantage to hamper tumor angiogenesis PMID: 21643009
  28. IL-3 provides cellular protection against amyloid-beta neurotoxicity in primary cortical neuronal cells and may play a neuroprotective role in Alzheimer's disease. PMID: 20964623
  29. The IL3 genotypes rs40401 and rs40401 were found to exert a protective effect against malaria attacks. PMID: 21224257
  30. Data indicate a role for PLCgamma2 and Ca(2+) signaling through the modulation of MEK/ERK in IL3/GM-csf stimulated human hematopoietic stem/progenitor cells. PMID: 21506110
  31. The interaction of 6-locus from the 5 interleukin genes might confer higher risk for graves'disease and Graves'ophthalmopathy than single risk allele. PMID: 20332709
  32. IL-3 genotypes of 60 acute rejection (AR) subjects and the 270 patients without AR demonstrated a significant relationship between genotype frequencies and the SNPs PMID: 21168724
  33. Human IL-3/GM-CSF knock-in mice support human alveolar macrophage development and human immune responses in the lung. PMID: 21262803
  34. propose that RhoH functions as a negative regulator for IL3-induced signals through modulation of the JAK-STAT pathway PMID: 20738848
  35. the domain 1 D-E loop disulfide of hbetac and beta(IL-3) in maintaining the precise positions of ligand-binding residues necessary for normal high affinity binding and signaling PMID: 20516062
  36. Two different modes of beta c binding are utilized in the presence of the hIL-3R alpha isoforms. PMID: 20472554
  37. a novel role for VPA in enhancing the potential of IL-3 to stimulate megakaryopoiesis as well as erythropoiesis PMID: 20381581
  38. The IL-3/GM-CSF locus undergoes progressive stages of activation, with stepwise increases in active modifications and the proportion of cytokine-expressing cells, throughout the course of T cell differentiation. PMID: 20147630
  39. IL-3 and oncogenic Abl regulate the myeloblast transcriptome by altering mRNA stability PMID: 19829692
  40. binding kinetics of native IL-3 and several variants to IL-3 receptor PMID: 11700046
  41. IL-3 induces MHC class II and B7.2 expression on eosinophils and renders them capable of supporting T cell proliferation to superantigen and antigen-derived peptides. PMID: 11714768
  42. inhibition of signaling by antisense oligodeoxynucleotides targeting the common beta chain of receptors PMID: 11763346
  43. ectopically expressed in myeloid leukemic cells with t(5;12)(q31;p13), suggesting that expression of IL3 was deregulated by the translocation, indicating a variant leukemogenic mechanism for translocations involving the 5' end of ETV6 PMID: 11861295
  44. Antiapoptotic cytokine IL-3 + SCF + FLT3L influence on proliferation of gamma-irradiated AC133+/CD34+ progenitor cells. PMID: 12002675
  45. Monocytes cultured in the presence of IL-3 (plus IL-4) differentiate into dendritic cells that produce less IL-12 and shift T helper (Th) cell responses toward a Th2 cytokine pattern. PMID: 12055233
  46. Data suggest that increased activity of mutated interleukin 3 is due to a change from a rare ligand to a common one, allowing the increase in IL-3-dependent signaling. PMID: 12093816
  47. role in potentiating hematopoietic cell migration PMID: 12135758
  48. The IL-3 gene is regulated by two enhancers that have distinct but overlapping tissue specificities. PMID: 12165512
  49. WEHI-3B-derived IL-3 stimulation of mcl-1 gene transcription through the SIE motif involves phosphorylation of PU.1 at serine 142 by a p38(MAPK)-dependent pathway. PMID: 12612065
  50. Incubation of eosinophils with IL-3 leads to reduced expression of IL-5R alpha which is sustained for up to 5 days; in contrast, expression of IL-3R alpha is increased by IL-3, whereas GM-CSF receptor alpha expression in eosinophils is unaffected by IL-3. PMID: 12759409

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
IL-3 family
Tissue Specificity
Activated T-cells, mast cells, natural killer cells.
Database Links

HGNC: 6011

OMIM: 147740

KEGG: hsa:3562

STRING: 9606.ENSP00000296870

UniGene: Hs.694

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*