Recombinant Human Interleukin-3(IL3)

In Stock
Code CSB-AP004531HU
Product Type Interleukin
Size $137Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P08700
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 0.5 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Research Area Immunology
Source E.coli
Gene Names IL3
Expression Region 20-152aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 16.6 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; FUNCTION
Subcellular Location Secreted
Protein Families IL-3 family
Tissue Specificity Activated T-cells, mast cells, natural killer cells.
Database Links

HGNC: 6011

OMIM: 147740

KEGG: hsa:3562

STRING: 9606.ENSP00000296870

UniGene: Hs.694

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Fc epsilon RI signaling pathway
Hematopoietic cell lineage

Related Products

IL3 Antibodies

IL3 Antibodies for Homo sapiens (Human)

IL3 Antibodies for Human

IL3 Proteins

IL3 Proteins for Homo sapiens (Human)

IL3 ELISA Kit

IL3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.