Recombinant Human Interleukin-6(IL6)

Code CSB-RP067544h
Size US$1198
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names IL6
Uniprot No. P05231
Research Area Immunology
Alternative Names Interleukin BSF 2; B cell differentiation factor; B cell stimulatory factor 2; B-cell stimulatory factor 2; BSF 2; BSF-2; BSF2; CDF; CTL differentiation factor; Cytotoxic T cell differentiation factor; Hepatocyte stimulating factor; Hepatocyte stimulatory factor; HGF; HSF; Hybridoma growth factor; Hybridoma growth factor Interferon beta-2; Hybridoma plasmacytoma growth factor; IFN-beta-2; IFNB2; IL 6; IL-6; IL6; IL6_HUMAN; Interferon beta 2 ; Interferon beta-2; Interleukin 6 ; Interleukin 6 (interferon beta 2); Interleukin BSF 2; Interleukin-6
Species Homo sapiens (Human)
Source E.coli
Expression Region 30-212aa
Target Protein Sequence VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 24.8kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation.
Gene References into Functions
  1. Acute exercise in children with juvenile idiopathic arthritis induced slightly musculoskeletal leg pain and transient increased plasma calprotectin levels but not IL-6 levels PMID: 30008613
  2. Genotype frequencies in the degenerative lumbar scoliosis patients and controls revealed a significant difference for the IL6-572 G/C polymorphism. A significant association was found between the IL6-572 G/C polymorphism and measured bone mineral densities at the lumbar spine. PMID: 28378072
  3. In glioblastoma, colony-stimulating factor-1 and angiocrine IL-6 induce robust arginase-1 expression and macrophage alternative activation, mediated through peroxisome proliferator-activated receptor-gamma-dependent transcriptional activation of hypoxia-inducible factor-2alpha. PMID: 29422647
  4. study demonstrated novel molecular events for leptin-induced inflammation in ligamentum flavum (LF) tissue by promoting IL-6 expression and thus might have potential implications for clarifying the mechanism underlying LF fibrosis and hypertrophy. PMID: 29436483
  5. The objective of this study was to evaluate the diagnostic value of serum and synovial fluid interleukin (IL)-6 levels for Periprosthetic Joint Infection. PMID: 28473693
  6. The elevated levels of both serum Shh and IL-6 were mainly observed in BC patients who had a significantly higher risk of early recurrence and bone metastasis, and associated with a worse survival for patients with progressive metastatic BC. PMID: 28496132
  7. study suggests that-174 G/C polymorphism of IL-6 gene differs in athletes, G allele and GG genotype is higher than the other ones, at least in Turkish athletes, and therefore should be taken into consideration when determining genetic aspects of athletes. PMID: 30213294
  8. studies reveal that IL-6 action in T cells through classical IL-6 signalling promotes inflammation and insulin resistance early during obesity development, which can be compensated for by enhanced IL-6 trans-signalling at later stages PMID: 28466852
  9. IL-6 signalling in primary human macrophages increased intracellular Bacillus Calmette-Guerin (BCG) and Mycobacterium tuberculosis numbers in a dose-dependent manner promoting mycobacterial survival and BCG-induced lipid accumulation. PMID: 28262681
  10. The analysis of the effect of the individual SNPs(PON1, IL-6, ITGB3, and ALDH2 ) and GRS groups on different lipid profile parameters revealed no significant association of any of the tested SNPs with any lipid parameter, however, the GRS groups showed marginally significant for TC and highly significant association for TG, LDL-c and HDL-c PMID: 30261890
  11. Our results showed that IL-37 plays an inhibitory role in non-small cell lung cancer progression, possibly by suppressing STAT3 activation and decreasing epithelial-to-mesenchymal transition by inhibiting IL-6 expression. IL-37 could serve as a potential novel tumor suppressor in non-small cell lung cancer PMID: 29575809
  12. Although interleukin-6 (IL-6) mRNA level was higher in 3D-culured cells, its secretion levels were higher in 2D-cultured cells. In addition, the levels of mRNA and protein expression of regnase-1, regulatory RNase of inflammatory cytokine, significantly increased in 3D culture, suggesting post-translational modification of IL-6 mRNA via regnase-1. PMID: 30096769
  13. indicate that the distribution of IL6-174G/C (rs1800795) SNP was marginally associated with multiple sclerosis susceptibility PMID: 30069682
  14. FABP5 promotes tumor angiogenesis via activation of the IL6/STAT3/VEGFA signaling pathway in hepatocellular carcinoma. PMID: 29957468
  15. Authors found that the IL-6 serum level was significantly higher in the SIRS group than in the control group. A significant association was observed in the genotypic distribution of the IL-6 - 572G allele in the SIRS group, when compared with the control group, and SIRS is more likely to occur in wasp sting patients with more than 10 stings. PMID: 30265566
  16. adipocytes are capable of enhancing IL-6 production by CD4(+) T cells PMID: 29283192
  17. Studied association of levels of IL-6 (interleukin-6) and TGF-beta in the pathogenesis of idiopathic epistaxis. PMID: 29893909
  18. LL was significantly negatively correlated with PGC-1alpha, TNF-alpha, and IL-6 mRNA expressions. PGC-1alpha mRNA expression levels in paraspinal muscles may be affected by lumbar kyphosis. PMID: 30233161
  19. Study found that IL-6 and IL-8 are necessary and sufficient to increase tumor cell migration in a cell density dependent manner with negligible feedback on cell proliferation. This effect is specific to metastatic cancer cells; IL-6 and IL-8 have no effect on the migration of normal and non-metastatic cancer cells. PMID: 28548090
  20. Rheumatoid arthritis patients who had the best response to tocilimuzab had the highest levels of IL6 and the lowest levels of soluble IL6 receptor. PMID: 29157669
  21. High IL6 expression is associated with retinopathy of prematurity. PMID: 29274846
  22. Adult serum IL-6 levels were predicted across periods as long as 15 years by adolescents' inability to defuse peer aggression and poor peer-rated conflict resolution skills, and by independently observed romantic partner hostility in late adolescence. PMID: 29212559
  23. Lysophosphatidylcholine induces COX-2-mediated IL-6 expression. NADPH oxidase/Reactive Oxygen Species is involved in Lysophosphatidylcholine-induced COX-2 expression. PMID: 30229288
  24. The expression of IL-6 gene and protein was significantly induced by IL-17F. IL-17F activated TAK1 and NF-kappaB in airway smooth muscle cells. PMID: 28474507
  25. IL-6 was over-expressed in SF from OA patients compared with normal donors. DNA hypomethylation and histone hyperacetylation were observed in the IL-6 promoter region in OA SF compared with normal SF. No differences in the status of H3K9 di-methylation, H3K27 tri-methylation and H3K4 tri-methylation in the IL-6 promoter region were observed between normal and OA SF. PMID: 28262826
  26. Increased serum IL6 concentrations are associated with obstructive sleep apnea and glycemic status. PMID: 29305826
  27. Study showed that activation of NF-kappaB/IL-6 is involved in moderate hyperthermia treatment induced progression of hepatocellular carcinoma cells. PMID: 29894725
  28. the polymorphism rs1800795 is associated with serum IL-6 level and level of neuroblastoma risk; GG genotype might indicate that the tumor is highly malignant (prone to metastasis) and associated with poor prognosis PMID: 29692379
  29. Findings indicate that childhood infections do not have an independent, lasting effect on circulating inflammatory marker levels subsequently in childhood; however, elevated inflammatory markers may be harmful for intellectual development/function. PMID: 29198208
  30. This study found that the protein and mRNA expression levels of the IL-6 is significantly increased. PMID: 28476335
  31. IL-6 may be used as a tumor marker for cancer diagnosis. It may be a clinically significant predictor and may represent a target for cancer treatment. However, to definitely conclude this, further extensive studies would be required PMID: 30249899
  32. The findings suggest that male factor infertility might be associated with an increased level of interleukin-6. PMID: 28523952
  33. Individuals with posttraumatic stress disorder showed a significant increase in the serum levels of IL-6 (and IL-10). PMID: 29179015
  34. Data suggest that, in children with pediatric obesity, lifestyle weight-loss intervention results in down-regulation of serum cardiotrophin-1 (CTF1), interleukin-6 (IL6), and tumor necrosis factor-alpha (TNFA); expression of CTF1, IL6, and TNFA is also down-regulated in peripheral blood mononuclear cells after improvement in adiposity, body mass index, and waist-hip ratio. PMID: 28749076
  35. Findings outlined in the current study demonstrated that the inhibition of P16 decreased the growth and metastasis potential of BC cells by inhibiting IL-6/JAK2/STAT3 signaling. PMID: 29388151
  36. The G/C genotype and the minor allele C of the IL-6 rs1800795 SNP were more common in individuals with Type 2 Diabetes Mellitus than controls (p = 0.004, odds ratio [OR] = 1.98, 95% confidence interval [CI]: 1.24-3.18 and p = 0.011, OR = 1.59, 95% CI: 1.11-2.26, respectively). PMID: 29957071
  37. The C allele of rs1800795 within IL-6 gene promoter, rs1800795-tobacco smoking and rs1800795-alcohol drinking interaction were all associated with increased CAD risk. PMID: 29889576
  38. study emphasizes the importance of -572G > C polymorphism in increasing IL-6 levels, thereby showing its significant role in DVT in India. PMID: 29890913
  39. Interleukin-6 Single Nucleotide Polymorphism is associated with Prostate Adenocarcinoma and Bone Metastasis. PMID: 29938471
  40. In a multi-ethnic population with nonalcoholic fatty liver disease, IL-6 is independently associated with the prevalence and severity of subclinical coronary atherosclerosis. PMID: 29579601
  41. in the patients with primary depression, depressive symptoms were associated with IL-6 PMID: 30148175
  42. eNOS knockdown greatly enhanced endothelial IL-6 production and permeability in response to LPS. Knockdown of eNOS enhanced LPS-induced p38. Inhibition of p38 with SB203580 prevented IL-6 production, without altering permeability PMID: 29061842
  43. The expression of the inflammatory cytokines interleukin (IL)6 and IL8 was significantly increased in endometriotic and cocultured cells compared with healthy ECs. PMID: 29901132
  44. Leptin-to-adiponectin ratio and IL-6 were elevated in men with prostate cancer. Leptin, chemerin and IL-6 were associated with Gleason score. The relationships between leptin, chemerin and IL-6 were dependent on each other. PMID: 29465157
  45. Collective evidence is supportive of the idea that IL-6 is an important participant during the EMT process in human intrahepatic biliary epithelial cells (HIBECs), as IL-6 stimulation can enhance the migration abilities of HIBEC, promote HIBEC cellular senescence and inhibit apoptosis of HIBECs, resulting in the EMT transformation of HIBECs. PMID: 28857276
  46. Our findings suggest that IL-6-mediated cross-talk between preadipocytes and breast DCIS cells can promote the progression of early stage breast cancer. PMID: 30134951
  47. Our study suggests the second day as the golden time for measuring the serum levels of IL-6. These findings warn us to take more health care actions in patients with higher serum levels of IL-6 on the second day. PMID: 29947344
  48. A small drug acting as a JAK1/2 inhibitor may also counteract the repressing effects of IL-6. PMID: 29162613
  49. addition of colivelin, a STAT3 activator, instead of IL-6 and C2C12 conditioned medium, promoted the myogenic differentiation of adipose tissue-derived stem cells. PMID: 29882916
  50. IL-6 G allele promoter increased stroke recurrent risk, therefore, it would be a predictor for recurrence of stroke in the young with moderate internal carotid artery stenosis. PMID: 29091301
  51. IL-6-174 G/C polymorphism was not statistically associated with RAS risk PMID: 29641282
  52. Priming cells with IFNbeta synergistically enhances IL6 induction in response to treatments that activate NF-kappaB, in a process that depends upon the recruitment of STAT2, IRF9. PMID: 29581268
  53. Genistein (GE) inhibited the growth of human Cholangiocarcinoma (CCA) cell lines by reducing the activation of EGFR and AKT, and by attenuating the production of IL6. E2 and ER were also involved in the growth-inhibitory effect of GE in CCA cells. PMID: 29693152
  54. NFAT1-regulated IL6 signalling contributes to aggressive phenotypes of glioma PMID: 29258522
  55. In Chinese Han population cardiovascular disease (CVD) risk is significantly higher in carriers with rs1800796-GC or CC genotype in interleukin 6 gene (IL-6) than those with GG genotype. CVD risk is the highest for rs1800796-GC or CC carriers with additional genetic polymorphism rs1800805-GA or AA in P-Selectin gene. PMID: 28819827
  56. When comparing pulmonary tuberculosis patients with latent TB infection subjects, significant associations with disease development were observed for SNPs of IL6 and TNFalpha. PMID: 29888256
  57. Serum IL-6 and fibrinogen levels seem to be two promising inflammatory markers in the discrimination of infected diabetic foot ulcer. PMID: 29675434
  58. higher levels of IL-6 and VEGF-A were significantly associated with shorter progression free survival in epithelial ovarian cancer PMID: 29572186
  59. evamisole inhibited CD138 expression and affected the levels of IL-6 in a dose-dependent manner. The results of the present study add new dimension to levamisole's mode of action as inhibitor of CD138 and IL-6 and as an antiapoptotic agent. PMID: 29798960
  60. Suppression of IL-6 remarkably promoted antitumor effect of gemcitabine. PMID: 29693005
  61. the polymorphism -174G>C in the IL-6 promoter region was associated with a significantly increased risk of obesity (Meta-Analysis) PMID: 30113463
  62. Serum IL-6 levels were significantly lower in children with febrile seizures as compared to febrile controls. PMID: 29428914
  63. Suggest IL-6 can induce hepcidin in systemic lupus erythematosus flares. PMID: 27416847
  64. The levels of salivary IL-6 and IL-17 were increased significantly in calculus associated Chronic periodontitis patients. PMID: 29670909
  65. Interleukin-6 was upregulated in blood of gastric cancer patients and study results indicate that Interleukin-6 promotes tumor growth and metastasis in gastric cancer PMID: 29710474
  66. interleukin 6 (IL-6) was secreted by bystander unirradiated cells (UICs), particularly the UICs with pre-induced autophagy. PMID: 29385614
  67. the activation of STAT3, a major tumourigenic IL-6 effector, was examined in adipose-derived stem cells conditioned medium treated endometrial cancer cells. PMID: 29684351
  68. High serum IL6 is associated with inflammatory mechanism and insulin resistance in the pathogenesis of diabetic nephropathy in type 2 diabetes mellitus patients. PMID: 28864059
  69. serum concentrations of IL-6 and PINP change in liver diseases, and those changes reflect the severity of liver disease. PMID: 29272979
  70. IL6 genetic polymorphism occurred more frequently in the individuals with Septic Arthroplasty failure - Periprosthetic Joint Infection. PMID: 29305046
  71. Potential role of IL-6 cytokine in triggering Endothelial Cell alterations in Amyotrophic Lateral Sclerosis is reviewed. PMID: 29385088
  72. suggest that cardamonin inhibits TNF-alpha, IL-6 and NO production and downregulates iNOS expression and NF-kappaB activation. PMID: 29303022
  73. CC homozygosis in the SNP - 174 G>C gene promoter of IL-6 can be proposed as one of the gene variants influencing iron accumulation in male adults with HFE mutations. PMID: 29656314
  74. Results show that carcinomaassociated fibroblasts (CAFs) could highly secrete IL6 which promotes betaTGFmediated EMT in ovarian cancer cells via the JAK2/STAT3 signaling pathway, leading to promoted proliferation and invasion of ovarian cancer cells, as well as inhibited apoptosis and paclitaxel resistance. PMID: 29565447
  75. 174 G/C polymorphism protective against preterm birth PMID: 28279124
  76. LPS stimulation induced TLR4 expression and increased pigmentation. TLR4 expression was not detected after single-dose UVA or UVB treatment, but pigmentation increased. Repeated UV treatment induced TLR4 expression and increased pigmentation. LPS stimulation and repeated UV treatment increased IL-6 secretion, and repeated UVB treatment increased IL-10 secretion. PMID: 29063638
  77. IL-6 may contribute to the accumulation of CD4 T cells in giant cell arteritis by supporting their proliferation and survival within the arterial wall through mechanisms that are independent of effects on local T reg expansion. PMID: 29414433
  78. Studied effects of dexamethasone on gene expression regulation of sirtuin 1 (SIRT1), interleukin 6 (IL6), and endothelin 1 (EDN1) in gingival derived aging stem cells. Dexamethasone downregulated expression of SIRT1 and IL6 but upregulated EDN1 in stem cells. PMID: 29302812
  79. IL-6 is associated with the angiogenic activity of tissue factor, and both are present in the same abnormal endothelial cells and pericytes PMID: 27542852
  80. tyrphostin B42 induced the apoptosis of pancreatic cancer cells (PCCs) by regulating the expression of mitochondrialrelated genes. Therefore, these findings demonstrated that tyrphostin B42 attenuated trichostatin A resistance in PCCs by antagonizing the IL6/JAK2/STAT3 signaling PMID: 29393444
  81. these results provide evidence that crocin has the potential for anticancer activity through inhibition of the IL-6/STAT3 signaling pathway, especially in liver cancer. PMID: 29393468
  82. significant correlation between IL-6 secretion and interstitial dendritic cell density in the biopsy for suspected T-cell mediated rejection after kidney transplantation PMID: 28906029
  83. we observed that IL-6, IL-17A and NO production in the tears and sera of all patients was strongly associated with inflammatory infiltration, NOS2, NF-kappaB and Bcl2 expression in pterygia biopsies. Collectively, our results indicate a relationship between local inflammation and anti-apoptotic processes in pterygium disease, leading to both tissue damage and enhanced cellular proliferation. PMID: 29164949
  84. IL6 rs1800796 SNP is a good marker for hip fracture risk in Mexican women. PMID: 28593468
  85. Data suggest that oxidative stress in PCOS (polycystic ovary syndrome) is associated with ovarian inflammation; biomarkers of oxidative stress [IL6, interleukin-6; IL8, interleukin-8; TNFA, tumor necrosis factor-alpha] are up-regulated in follicular fluid of women with PCOS as compared to control subjects. PMID: 28868943
  86. MIF and IL-6 play important roles in the inflammation associated with polymyositis. PMID: 29239244
  87. G-CSF and IL-6 concentrations may be predictive of the onset of neonatal Leukemoid reaction. PMID: 29459579
  88. Data suggest that, for overweight and obese men, a 12-week period of healthy lifestyle modifications induces decreases in serum cytokine levels (especially IL6 levels) and leads to decreases in arterial stiffness (as assessed by brachial-ankle pulse wave velocity). This study was conducted in Japan. PMID: 28966223
  89. In conclusion,IL-6 or its receptor gene variants cannot be used as markers for identification of Czech patients with increased risk of recurrent aphthous stomatitis PMID: 28543912
  90. High IL6 expression is associated with poor response to anti-rheumatic drug treatment in rheumatoid arthritis patients. PMID: 29787569
  91. data showed that activation of NF-kappaB/IL-6 is involved in estrogen-related receptor alpha induced migration and invasion of non-small cell lung cancer cells; it suggested that ERRalpha might be a potential target for non-small cell lung cancer treatment PMID: 29862528
  92. IL-6 rs1800795 polymorphism is a protective factor for polycycstic ovary syndrome susceptibility. Given the limited ethnic groups and sample size, further studies are required to validate the association. PMID: 30024552
  93. Data (including data from studies using transgenic/knockout mice) suggest that signaling via IL6/IL6R couples autophagy to antioxidant response in insulin-secreting cells. (IL6 = interleukin-6; IL6R = interleukin-6 receptor) PMID: 29784660
  94. Interleukin-6 levels were associated with postoperative mortality in a cardiac surgery population. PMID: 28737097
  95. http://Serum interleukin-6 and tumor necrosis factor-alpha are associated with early graft regeneration after living donor liver transplantation PMID: 29649247
  96. Higher average maternal interleukin-6 concentration during pregnancy was prospectively associated with larger right amygdala volume and stronger bilateral amygdala connectivity to brain regions involved in sensory processing and integration, salience detection, and learning and memory. PMID: 28754515
  97. The results indicated that the expression levels of interleukin6 and inducible nitric oxide synthase (iNOS) were decreased, whereas collagen expression and deposition were increased in ketaminetreated SMCs. Conversely, treatment with CTX restored the expression of iNOS, which may prevent or limit oxidative damage PMID: 29207018
  98. IL-6-G174C polymorphism may affect susceptibility to idiopathic nephrotic syndrome and might affect steroid response. PMID: 29190601
  99. These findings from this study indicate that IL-6 contributes to human allergic disease by enhancing the production of inflammatory PGD2 from tissue-resident mast cells. PMID: 29410184
  100. levels in interstitial skin fluid increased significantly after UVA-1 exposure PMID: 28094867

Show More

Hide All

Involvement in disease Rheumatoid arthritis systemic juvenile (RASJ)
Subcellular Location Secreted
Protein Families IL-6 superfamily
Database Links

HGNC: 6018

OMIM: 147620

KEGG: hsa:3569

STRING: 9606.ENSP00000258743

UniGene: Hs.654458

Most popular with customers

  Tel: 301-363-4651
  Email: support@cusabio.com
  Distributors Worldwide

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1