Recombinant Human Serine/threonine-protein kinase PAK 1 (PAK1)

In Stock
Code CSB-EP613382HU
Abbreviation Recombinant Human PAK1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Apoptosis
Alternative Names
ADRB2; Alpha PAK; Alpha-PAK; MGC130000; MGC130001; p21 activated kinase 1; p21 protein (Cdc42/Rac) activated kinase 1; p21-activated kinase 1; p21/Cdc42/Rac1 activated kinase 1 (yeast Ste20 related); p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast); p65 PAK; p65-PAK; P68-PAK; PAK alpha; PAK-1; Pak1; PAK1_HUMAN; Paka; PAKalpha; Protein kinase MUK2; Rac/p21-activated kinase; Serine/threonine-protein kinase PAK 1; STE20 homolog yeast
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-545aa
Target Protein Sequence
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
76.6kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Introducing Recombinant Human PAK1 protein, a valuable tool for your apoptosis research endeavors. Serine/threonine-protein kinase PAK 1, also known as Alpha-PAK, p21-activated kinase 1, or p65-PAK, is a crucial mediator of apoptosis and other cellular processes, such as cell motility, proliferation, and differentiation. PAK1 plays a critical role in a variety of signaling pathways, making it an essential target for understanding the complex mechanisms of apoptosis regulation.

Our Recombinant Human PAK1 protein is produced in E.coli, ensuring robust expression of the full-length protein (1-545aa). The N-terminal 6xHis-SUMO tag allows for efficient purification and detection while preserving the protein's native structure and function. With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Human PAK1 protein ensures reliability and reproducibility in your experiments. Available in both liquid and lyophilized powder forms, our product offers the flexibility to meet your specific research needs.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Protein kinase involved in intracellular signaling pathways downstream of integrins and receptor-type kinases that plays an important role in cytoskeleton dynamics, in cell adhesion, migration, proliferation, apoptosis, mitosis, and in vesicle-mediated transport processes. Can directly phosphorylate BAD and protects cells against apoptosis. Activated by interaction with CDC42 and RAC1. Functions as GTPase effector that links the Rho-related GTPases CDC42 and RAC1 to the JNK MAP kinase pathway. Phosphorylates and activates MAP2K1, and thereby mediates activation of downstream MAP kinases. Involved in the reorganization of the actin cytoskeleton, actin stress fibers and of focal adhesion complexes. Phosphorylates the tubulin chaperone TBCB and thereby plays a role in the regulation of microtubule biogenesis and organization of the tubulin cytoskeleton. Plays a role in the regulation of insulin secretion in response to elevated glucose levels. Part of a ternary complex that contains PAK1, DVL1 and MUSK that is important for MUSK-dependent regulation of AChR clustering during the formation of the neuromuscular junction (NMJ). Activity is inhibited in cells undergoing apoptosis, potentially due to binding of CDC2L1 and CDC2L2. Phosphorylates MYL9/MLC2. Phosphorylates RAF1 at 'Ser-338' and 'Ser-339' resulting in: activation of RAF1, stimulation of RAF1 translocation to mitochondria, phosphorylation of BAD by RAF1, and RAF1 binding to BCL2. Phosphorylates SNAI1 at 'Ser-246' promoting its transcriptional repressor activity by increasing its accumulation in the nucleus. In podocytes, promotes NR3C2 nuclear localization. Required for atypical chemokine receptor ACKR2-induced phosphorylation of LIMK1 and cofilin (CFL1) and for the up-regulation of ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. In synapses, seems to mediate the regulation of F-actin cluster formation performed by SHANK3, maybe through CFL1 phosphorylation and inactivation. Plays a role in RUFY3-mediated facilitating gastric cancer cells migration and invasion. In response to DNA damage, phosphorylates MORC2 which activates its ATPase activity and facilitates chromatin remodeling. In neurons, plays a crucial role in regulating GABA(A) receptor synaptic stability and hence GABAergic inhibitory synaptic transmission through its role in F-actin stabilization. In hippocampal neurons, necessary for the formation of dendritic spines and excitatory synapses; this function is dependent on kinase activity and may be exerted by the regulation of actomyosin contractility through the phosphorylation of myosin II regulatory light chain (MLC). Along with GIT1, positively regulates microtubule nucleation during interphase.
Gene References into Functions
  1. PAK1 gene silencing decreases proliferation of MHCC97-H cells, HepG2 cells and cells in xenograft tumor through the p53/p21 pathway. PMID: 29802374
  2. PAK1 silencing attenuated cell cycle progression, inducing apoptosis. Inhibition of PAK1 expression reduced tumor sizes and masses by modulating CREB expression and activation. PMID: 30282071
  3. Once activated, c-Abl kinase regulated the activity of Vav1, which further affected Rac1/PAK1/LIMK1/cofilin signaling pathway. PMID: 29058761
  4. The nuclear functions of PAK1 and its role in the regulation of DNA damage repair is reviewed. PMID: 29597073
  5. PAK1 is upregulated in cutaneous T cell lymphoma. PAK1 silencing induced apoptosis and inhibited cell growth by stimulating the expression of PUMA and p21. PMID: 29307600
  6. Results show that JMJD6 regulates the alternative splicing of PAK1 in melanoma cells. PMID: 29187213
  7. PAK1 expression, evaluated by immunohistochemistry, was positively correlated with pERK and beta-catenin expression in lung tumors. Patients with high-PAK1, high-pERK, and high-nuclear beta-catenin tumors more frequently showed an unfavorable response to cisplatin-based chemotherapy when compared to their counterparts. PMID: 27713506
  8. PKC-zeta may be responsible for the abnormal growth, proliferation, and migration of metastatic LOVO colon cancer cells via PKC-zeta/Rac1/Pak1/beta-Catenin pathway. PMID: 29408512
  9. High expression of PAK1 is associated with invasion of gastric cancer. PMID: 28534988
  10. Molecular modelling studies of PAK1 with its major interacting partners RHOA and STAT3 revealed potential network gene elements in breast invasive carcinoma. PMID: 27456030
  11. miR4855p reverses EMT and promotes cisplatin-induced cell death by targeting PAK1 in oral tongue squamous cell carcinoma. This study suggests that PAK1 plays an essential role in the progression of OSCC and it is a potential therapeutic target for OSCC. PMID: 28535002
  12. Because reduced PAK1 activity impaired FA/BRCA function, inhibition of this kinase in PAK1 amplified and/or overexpressing breast cancer cells represents a plausible strategy for expanding the utility of PARP inhibitors to FA/BRCA-proficient cancers. PMID: 27740936
  13. Overall, the authors find that p27 directly promotes cell invasion by facilitating invadopodia turnover via the Rac1/PAK1/Cortactin pathway. PMID: 28287395
  14. Results show that Pak1 is overexpressed in breast cancer cells and tissues, and found that Pak1 is a hormone responsive gene, whose expression can be modulated by steroid hormones, estrogen (E2) and progesterone (P4). Pak1 promoter analysis showed that PR mediates promoter activity via its binding to PRE present on the Pak1 promoter. PMID: 29274909
  15. PAK1 confers TKI resistance in EGFR-mutant cells as well as in EGFR-wild-type cells. PMID: 27178741
  16. Our findings offer an insight for the new drug development of PAK1 inhibitor. We also provide a possible explanation for the phenomenon that the application of the chlorhexidine in peritoneal lavage inhibited the development of tumor. PMID: 29146188
  17. To our knowledge, this is the first study illustrating the mechanistic role of Pak1 in causing gemcitabine resistance via multiple signaling crosstalks, and hence Pak1-specific inhibitors will prove to be a better adjuvant with existing chemotherapy modality for pancreatic ductal adenocarcinoma (PDAC) PMID: 27117533
  18. Studies indicate that PAK1 expression may be a predictive marker of overall survival and disease-specific survival in patients with solid tumors. PMID: 27027431
  19. Results from our analysis showed that Pak1 overexpression, knockdown and Pak1 knockout cell line models showed that Pak1 confers protection to keratinocytes from UV-B-induced apoptosis and DNA damage via ATR. PMID: 28692051
  20. the oxidative stress-induced down-regulation of PAK1 activity could be involved in the loss of mesencephalic dopaminergic neurons. PMID: 27121078
  21. the expression of PAK1 is inversely correlated with the level of miR-494 in human breast cancer samples. Furthermore, re-expression of PAK1 partially reverses miR-494-mediated proliferative and clonogenic inhibition as well as migration and invasion suppression in breast cancer cells PMID: 28055013
  22. Our study revealed that PAK1 may play a crucial role in the progression of OSCC. Studying the role of PAK1 and its substrates is likely to enhance our understanding of oral carcinogenesis and potential therapeutic value of PAKs in oral cancer. PMID: 27229476
  23. The effect of PAK1 modulation on tumorigenesis, and on resistance to treatment with 5-fluorouracil (5-FU), was measured by sphere formation in vitro and by growth of xenografted tumors in vivo. The results show that PAK1 activity correlated with the expression of CSC markers and the CD44 isoform profile, and with tumor growth both in vitro and in vivo. PMID: 27260988
  24. this study shows that PAK1 may be a potential tumor marker and therapeutic target of prostate cancer PMID: 28186966
  25. Our results from clinical samples also suggest that Threonine 209 phosphorylation by Pak1 could be a potential therapeutic target and of great clinical relevance with implications for Runx3 inactivation in cancer cells where Runx3 is known to be oncogenic. The findings presented in this study provide evidence of Runx3-Threonine 209 phosphorylation as a molecular switch in dictating the tissue-specific dualistic functions PMID: 26898755
  26. Abnormalities in the PAK1 and PAK3 mRNA levels as well as their altered coexpression patterns were observed in the postmortem brain of subjects with depression. Dysregulated PAK1/PAK3 dependent signaling may be a key factor responsible for volumetric abnormalities observed in the hippocampus and in the prefrontal cortex in depression resulting in altered connectivity of these regions. PMID: 27474226
  27. Short-term treatment of nascent melanoma tumors with PAK inhibitors that block RhoJ signaling halts the growth of BRAF mutant melanoma tumors in vivo and induces apoptosis in melanoma cells in vitro via a BAD-dependent mechanism PMID: 28753606
  28. these data strongly support a critical interplay between prolactin and estrogen via PAK1 and suggest that ligand-independent activation of ERalpha through prolactin/PAK1 may impart resistance to anti-estrogen therapies. PMID: 26944939
  29. Given the central role of p21-Activated kinase 1 (PAK1) in vital signaling pathways, studies suggest that clinical development of PAK1 inhibitors will require careful investigation of their safety and efficacy. PMID: 28202661
  30. These findings suggest that small-molecule inhibitors of Pak1 may have a therapeutic role in the ~25% of ovarian cancers characterized by PAK1 gene amplification. PMID: 26257058
  31. autocrine VEGF and IL-8 promoted endothelial cell migration via the Src/Vav2/Rac1/PAK1 signaling pathway. PMID: 28278510
  32. These data provide insight into the mechanisms guiding PRL-mediated breast cancer cell motility and invasion and highlight a significant role for phosphoTyr-PAK1 in breast cancer metastasis. PMID: 27542844
  33. p120 participates in the progress of gastric cancer through regulating Rac1 and Pak1. PMID: 26324182
  34. The role of PAK1 in cancer drug resistance in BRAF-mutated cancer PMID: 28052407
  35. High p21-activated kinase 1 and cell division control protein 42 homolog expressions are closely related to the clinicopathological features and poor prognosis of cervical carcinoma, serving as unfavorable prognostic factors. PMID: 27060895
  36. miR7 negatively regulates PAK1 protein expression but has no effect on PAK1 mRNA expression. Knockdown of PAK1 expression markedly suppressed thyroid cancer cell proliferation, migration and invasion. PMID: 27430434
  37. Myricetin effectively suppressed the protein expression of p21-activated kinase 1 (PAK1). PMID: 27122002
  38. overexpression of PAK1, NEK6, AURKA, and AURKB genes in patients with Colorectal adenomatous polyp and colorectal cancer in the Turkish population. PMID: 26423403
  39. Pak1 expression is not associated with breast cancer recurrence and resistance to tamoxifen. PMID: 27056567
  40. 1alpha,25-Dihydroxy-Vitamin D3 leads to disruption of RAC1 and PAK1 activity with subsequent actin depolymerization of endometrial carcinoma cells. PMID: 27997893
  41. Study acts as a further supplement of the genetic features of neuroendocrine tumors. Somatic mutations of three potential tumor-related genes (HRAS, PAK1 and MEN1) might contribute to the tumorigenesis of thymic neuroendocrine tumors with EAS. PMID: 27913610
  42. PAK1-cofilin phosphorylation mechanism to mediate lung adenocarcinoma cells migration promoted by apelin-13 PMID: 26918678
  43. PAK-1 overexpression may be involved in colorectal carcinoma progression and could be considered an independent predictor of disease recurrence. PMID: 26884861
  44. Combination of a PAK1 inhibitor such as FRAX597 with cytotoxic chemotherapy deserves further study as a novel therapeutic approach to pancreatic cancer treatment. PMID: 26774265
  45. beta-elemene enhances radiosensitivity of gastric cancer cells by inhibiting Pak1 signaling. PMID: 26379399
  46. PAK1 nuclear translocation is ligand-dependent: only PRL but not E2 stimulated PAK1 nuclear translocation PMID: 27003261
  47. These findings indicate that genetic variants in PAK1 gene may contribute to susceptibility to lung cancer in the Chinese population. PMID: 26377044
  48. Formation of filopodia by membrane glycoprotein M6a (Gpm6a) requires actin regulator coronin-1a (Coro1a), known to regulate plasma membrane localization and activation of Rac1 and its downstream effector Pak1. PMID: 26809475
  49. This study showed that PAK1 messenger RNA levels were significantly downregulated specifically in deep layer 3 pyramidal cells in patient with schizophrenia. PMID: 25981171
  50. Data show association of G protein-coupled receptor kinase-interacting protein 1 (GIT1), p21-activated kinase interacting exchange factor (betaPIX), and p21 protein (Cdc42/Rac)-activated kinase 1 (PAK1) with centrosomes. PMID: 27012601

Show More

Hide All

Subcellular Location
Cytoplasm. Cell junction, focal adhesion. Cell projection, lamellipodium. Cell membrane. Cell projection, ruffle membrane. Cell projection, invadopodium. Nucleus, nucleoplasm. Chromosome. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily
Tissue Specificity
Overexpressed in gastric cancer cells and tissues (at protein level).
Database Links

HGNC: 8590

OMIM: 602590

KEGG: hsa:5058

STRING: 9606.ENSP00000278568

UniGene: Hs.435714

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*