Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Code | CSB-EP897523HU |
Size | $1812 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | TNFSF13B |
Uniprot No. | Q9Y275 |
Research Area | Cancer |
Alternative Names |
ApoL related ligand TALL 1; B cell Activating Factor; B lymphocyte stimulator; B-cell-activating factor; BAFF; BLyS; CD 257; CD257; CD257 antigen; Delta BAFF; Dendritic cell derived TNF like molecule; Dendritic cell-derived TNF-like molecule; DTL; DTL precursor; PRO738; soluble form; TALL 1; TALL-1; TALL1; THANK; TN13B_HUMAN; TNF and APOL related leukocyte expressed ligand 1; TNF homolog that activates apoptosis ; TNF homolog that activates apoptosis NKFB and JNK.; TNF- and APOL-related leukocyte expressed ligand 1; TNFSF13B; TNFSF20; TNLG7A; Tumor necrosis factor (ligand) superfamily member 13b; Tumor necrosis factor ligand 7A; Tumor necrosis factor ligand superfamily member 13b; Tumor necrosis factor ligand superfamily member 20; Tumor necrosis factor like protein ZTNF4; Tumor necrosis factor superfamily member 13B; UNQ401; ZTNF4
|
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 68-285aa |
Target Protein Sequence | QVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 39.7kDa |
Protein Length | Extracellular Domain |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. A third B-cell specific BAFF-receptor (BAFFR/BR3) promotes the survival of mature B-cells and the B-cell response.; Isoform 2 seems to inhibit isoform 1 secretion and bioactivity.; Acts as a transcription factor for its own parent gene, in association with NF-kappa-B p50 subunit, at least in autoimmune and proliferative B-cell diseases. The presence of Delta4BAFF is essential for soluble BAFF release by IFNG/IFN-gamma-stimulated monocytes and for B-cell survival. It can directly or indirectly regulate the differential expression of a large number of genes involved in the innate immune response and the regulation of apoptosis.
|
Gene References into Functions |
|
Subcellular Location | Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor ligand superfamily member 13b, soluble form]: Secreted. |
Protein Families | Tumor necrosis factor family |
Tissue Specificity | Abundantly expressed in peripheral blood Leukocytes and is specifically expressed in monocytes and macrophages. Also found in the spleen, lymph node, bone marrow, T-cells and dendritic cells. A lower expression seen in placenta, heart, lung, fetal liver, |
Database Links |
HGNC: 11929 OMIM: 603969 KEGG: hsa:10673 STRING: 9606.ENSP00000365048 UniGene: Hs.525157 |