Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
ApoL related ligand TALL 1; B cell Activating Factor; B lymphocyte stimulator; B-cell-activating factor; BAFF; BLyS; CD 257; CD257; CD257 antigen; Delta BAFF; Dendritic cell derived TNF like molecule; Dendritic cell-derived TNF-like molecule; DTL; DTL precursor; PRO738; soluble form; TALL 1; TALL-1; TALL1; THANK; TN13B_HUMAN; TNF and APOL related leukocyte expressed ligand 1; TNF homolog that activates apoptosis ; TNF homolog that activates apoptosis NKFB and JNK.; TNF- and APOL-related leukocyte expressed ligand 1; TNFSF13B; TNFSF20; TNLG7A; Tumor necrosis factor (ligand) superfamily member 13b; Tumor necrosis factor ligand 7A; Tumor necrosis factor ligand superfamily member 13b; Tumor necrosis factor ligand superfamily member 20; Tumor necrosis factor like protein ZTNF4; Tumor necrosis factor superfamily member 13B; UNQ401; ZTNF4
Species
Homo sapiens (Human)
Expression Region
68-285aa
Target Protein Sequence
QVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
