Recombinant Human Urokinase-type plasminogen activator (PLAU), partial

In Stock
Code CSB-EP360437HU1
Abbreviation Recombinant Human PLAU protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
ATF; ATF uPA; BDPLT5; Plasminogen activator; Plasminogen activator urinary; Plasminogen activator urokinase; PLAU; QPD; u PA; U plasminogen activator; u-PA; U-plasminogen activator; uPA; URK; UROK_HUMAN; Urokinase plasminogen activator; Urokinase type plasminogen activator; Urokinase type plasminogen activator precursor; Urokinase-type plasminogen activator chain B
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
21-173aa
Target Protein Sequence
SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.3kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Urokinase-type plasminogen activator (PLAU) is expressed in E. coli and contains amino acids 21 to 173 of the protein. The protein carries an N-terminal 6xHis-tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows a purity level that exceeds 90%, suggesting high quality for research applications. This product is designed for research use only and is not intended for clinical applications.

Urokinase-type plasminogen activator (uPA) is a serine protease that appears to be critical in converting plasminogen to plasmin, a key enzyme involved in fibrinolysis. It likely plays a significant role in extracellular matrix degradation and tissue remodeling, influencing processes such as cell migration and tissue repair. Scientists widely study uPA for its involvement in various physiological and pathological pathways, making it an important target in research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant human PLAU is produced in an E. coli expression system as a partial fragment (21-173aa) with an N-terminal 6xHis-tag. PLAU is a eukaryotic serine protease that requires precise folding, disulfide bond formation, and proper tertiary structure for its enzymatic activity in plasminogen activation. E. coli, as a prokaryotic system, lacks the oxidative environment and chaperones necessary for correct disulfide bond formation and folding of complex eukaryotic proteins. The partial nature of the fragment (missing the signal peptide and potentially critical domains) further reduces the likelihood of correct folding and bioactivity. Purity >90% by SDS-PAGE is determined under denaturing conditions and does not confirm native folding or bioactivity. No validation data (e.g., enzymatic activity assays, circular dichroism) are provided. Therefore, the protein is highly likely to be misfolded and inactive, and applications should be considered high-risk without experimental validation.

1. Antibody Development and Characterization

This application is suitable as antibody generation primarily relies on linear epitope recognition, which is independent of folding status. The His-tag simplifies purification and immobilization for ELISA-based screening. However, if misfolded, generated antibodies may not optimally recognize conformational epitopes of native, properly folded PLAU in biological systems, limiting their utility for functional studies.

2. Biophysical Analysis

These studies are essential for determining folding status. Techniques should include circular dichroism spectroscopy to assess secondary structure, size-exclusion chromatography to evaluate oligomeric state, and thermal stability assays. However, the partial nature of the fragment limits insights into full-length PLAU.

Final Recommendation & Action Plan

Given the high probability of misfolding and inactivity due to E. coli expression and the partial fragment design, it is essential to validate the protein's folding and bioactivity before any application. The recommended action plan includes first performing functional assays (e.g., plasminogen activation assay) to confirm enzymatic activity and biophysical characterization (e.g., circular dichroism for secondary structure, size-exclusion chromatography for oligomeric state). If validation fails, consider using eukaryotic expression systems (e.g., mammalian or insect cells) for proper folding or obtain a commercially validated full-length PLAU. For immediate use, limit applications to antibody development with the understanding that antibodies may require additional validation against native protein, and avoid all functional studies until proper folding is confirmed.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Gene References into Functions
  1. The combination of decoy receptor 3, soluble urokinase type plasminogen activator receptor, and procalcitonin improved the sensitivity and specificity of diagnosis of sepsis, suggesting that use of the combination of three indexes enhanced the efficiency of sepsis diagnosis. PMID: 29760745
  2. High Expressions of PLAU is associated with lung adenocarcinoma. PMID: 28454121
  3. Increased expression of uPA in epidermal cells in psoriasis and in tumor cells in basal cell carcinomas suggests an important role of the uPA system for aggressively proliferating and invading cells of epidermal origin. PMID: 28429105
  4. study provides strong support in the role of L. reuteri in suppression of GC cell invasion by downregulation of pathways which is involved in extracellular matrix degradation such as uPA and uPAR PMID: 28643742
  5. Gelsolin enhances the invasive capacity of colon cancer cells via elevating intracellular superoxide (O2.-) levels by interacting with Cu/ZnSOD, and gelsolin gene expression positively correlates with urokinase plasminogen activator (uPA), an important matrix-degrading protease invovled in cancer invasion. PMID: 27391159
  6. Study provides evidence that the stimulation of u-PA/u-PAR system contributes to the activated phenotype and function of cancer-associated fibroblasts during multiple myeloma. PMID: 28340565
  7. OB-Rb, RhoA/ROCK, PI3K/AKT, JAK/STAT pathways and NF-kB activation are involved in leptin-induced upA expression. PMID: 28104444
  8. Results provide evidence that uPA and IGF1R directly interact with uPAR enhancing malignant potential of triple-negative breast cancer. PMID: 27502396
  9. suggest that the low endogenous levels of uPA in blood are actively regulated, and that the regulatory mechanisms are disrupted in QPD in a megakaryocyte-specific manner PMID: 28301587
  10. an intricate link between caveolin-1 and Src kinase-mediated cell signaling and alveolar epithelial cell apoptosis due to loss of SP-C expression through p53 and uPA system-mediated cross-talk, is reported. PMID: 28385810
  11. results show that the uPA/uPAR/LRP1 system is a potential target for the development of therapeutic strategies to promote axonal recovery following a CNS injury PMID: 27986809
  12. The present research concluded that aspirin suppressed prostate cancer cell invasion by reducing MMP-9 activity and uPA expression through decreasing of IKK-beta-mediated NF-kappaB activation, indicating that the ability of aspirin to inhibit cell invasion might be useful in the chemoprevention of metastatic prostate cancer. PMID: 28278500
  13. These studies identify uPA-dependent de-repression of vegfr1 and vegfr2 gene transcription through binding to HHEX/PRH as a novel mechanism by which uPA mediates the pro-angiogenic effects of VEGF and identifies a potential new target for control of pathologic angiogenesis. PMID: 27151212
  14. The up-regulation of uPA mRNAs was correlated with high-risk clinicopathological features, including extrathyroid invasion, loss of cellular polarity/cohesiveness, and the BRAF(V600E) mutation. PMID: 25085839
  15. Transplantation of uPA gene modified mesenchymal stem cells suppressed liver fibrosis and ameliorated liver function and may be a new approach to treating liver fibrosis PMID: 26877613
  16. ApaL1 and Taq1 single nucleotide polymorphisms of the urokinase and VDR genes are associated with recurrent urolithiasis in a Caucasian population. PMID: 26275878
  17. Resveratrol inhibited hypoxia-induced HIF-1alpha protein expression. Resveratrol also suppressed hypoxiainduced expression of metastatic-related factors, uPA and MMP2. PMID: 26707376
  18. Significance of the urokinase-type plasminogen activator and its receptor in the progression of focal segmental glomerulosclerosis in clinical and mouse models. PMID: 26846181
  19. Data suggest that enhanced levels of uPA in breast cancer modulate the mitogenic effects of EGF which helps to better understand breast cancer pathogenesis. PMID: 25641046
  20. Results found high levels of uPA and uPAR exclusively in metastatic osteosarcoma (OS)cells and suggest that malignant conversion of OS cells to uPA/uPAR axis in an autocrine and paracrine fashion. PMID: 26317203
  21. The morphologically normal tissue adjacent to the tumor shows the substantial expression of MMP-2 and MMP-9 and in some cases the enhanced activity of uPA and ACE, which makes an additional contribution to the increased invasive potential of tumor PMID: 26978018
  22. it was found that the recombinant fusion protein uPA17-34-KPI(kunitz-type protease inhibitor ) inhibited the invasion and metastasis of ovarian tumors PMID: 26166362
  23. Crystal structure of uPA bound with cyclic peptidic inhibitors. PMID: 25744057
  24. u-PA is a dysregulated gene involved in the tumorigenesis, bio-pathological features and outcomes of EEC. PMID: 26033187
  25. High cytoplasmic expression of uPA is associated with cells of rectal cancer and metastases of perienteric lymph nodes. PMID: 26504024
  26. DIM can influence the cell migratory and invasive properties of human colorectal cancer cells and may decrease the invasive capacity of colorectal cancer through downregulation of uPA and MMP9 mediated by suppression of the transcription factor FOXM1 PMID: 25962429
  27. Porphyromonas gingivalis-derived RgpA-Kgp complex activates the macrophage uPA. PMID: 25979345
  28. SNP P141L associated with collateral circulation in coronary artery disease PMID: 24952395
  29. Taking uPA(1-43) amino acids specifically binding to uPAR as targeted part of fusion protein, and making use of antitumor activity of melittin, the recombinant fusion protein it was able to inhibit growth of ovarian tumors . PMID: 25394558
  30. uPA/uPAR stimulates triglyceride synthesis in Huh7 hepatoma cells via p38-dependent upregulation of DGAT2 PMID: 25244504
  31. Studied urokinase-type plasminogen activator regulation in cigarette smoke extract (CSE)-induced EMT in human small airway epithelial cell lines (HSAEpiCs)and in the small airway epithelium of COPD patients. PMID: 25706093
  32. Silencing of ETV4 suppresses invasion of prostate cancer cells by inhibiting the expression of uPA/uPAR as well as (MMP)-2 and MMP-9 PMID: 25544710
  33. miR-193b inhibits the expression of stathmin 1 (STMN1) and urokinase-type plasminogen activator (uPA) in Panc-1 cells. PMID: 25215905
  34. Activation of uPA and MMP-3 in perifocal zone of the tumor can serve as an indexof its invasive activity. PMID: 25993872
  35. These data support the hypothesis that uPA upregulation stimulated by macrophages may play an active role in the onset of osteoarthritis and in the shear-stress protection against this induction. PMID: 23597113
  36. High preprocedural plasma uPA and serum CRP levels are indicative of angina recurrence after successful PTCA, and are valuable for the prognosis of restenosis. PMID: 24057344
  37. Data indicate that urokinase-type plasminogen activator (uPA) activates epithelial sodium channel, gamma subunit (ENaC gamma) through catalytic activity-dependent proteolytic modification. PMID: 25555911
  38. IL-17 may act as chemotropic factor for peripheral blood-Mesenchymal stem cellss by incrementing cell motility and uPA expression during inflammation development. PMID: 25433194
  39. Suggest a possible protective effect of podocyte uPA/uPAR expression against interstitial fibrosis in IgA nephritis. PMID: 24648800
  40. High u-PA expression is associated with metastasis in breast cancer. PMID: 24610082
  41. In human coronary vascular smooth muscle, uPA induces uPAR-independent, domain-dependent smooth muscle cell proliferation through transactivation of EGFR by a plasmin-mediated, ADAM-induced, and HB-EGF-dependent process. PMID: 25082749
  42. IL-33 is involved in u-PA-driven angiogenesis, a process that has been shown before to be linked to inflammation in various pathologies. PMID: 24702774
  43. IL-1beta-induced urokinase plasminogen activator expression via activation of the ERK1/2 and NF-kappaB pathways, which results in invasion of gastric cancer cells. PMID: 24626561
  44. Studied the relationship between uPA gene polymorphisms and clinical manifestations of idiopathic membranous nephropathy. PMID: 24822208
  45. These effects were mediated by the efficient conversion of pro-uPA to active uPA and high phosphorylation levels of ERK detected in the PANC-1 cells expressing exogenous polyserase-1. PMID: 24756697
  46. We found no association between allele frequency and risk of multiples sclerosis for any single nucleotide polymorphism investigated for PLAU PMID: 23897640
  47. results of this study suggest that uPA decreases the removal of HDL-cholesteryl ester in the liver via suppression of the hepatic scavenger receptor class B type I (SR-BI)expression PMID: 24529115
  48. Oncogenic K-Ras and loss of Smad4 mediate invasion by activating an EGFR/NF-kappaB Axis that induces expression of MMP9 and uPA in human pancreas progenitor cells. PMID: 24340014
  49. The findings provide evidence that the rs2227564 C/T SNP in the u-PA gene is associated with the development of oral tongue squamous cell carcinoma. PMID: 23621237
  50. Decreasing uPA levels sensitized cancer cells to TRAIL, leading to markedly increased apoptosis. PMID: 24481457

Show More

Hide All

Involvement in disease
Quebec platelet disorder (QPD)
Subcellular Location
Secreted.
Protein Families
Peptidase S1 family
Tissue Specificity
Expressed in the prostate gland and prostate cancers.
Database Links

HGNC: 9052

OMIM: 191840

KEGG: hsa:5328

STRING: 9606.ENSP00000361850

UniGene: Hs.77274

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*