Code | CSB-BP023452RA1 |
Size | US$1972 |
Image |
Purity | Greater than 85% as determined by SDS-PAGE. |
Target Names | Tgfbr2 |
Uniprot No. | P38438 |
Research Area | Signal Transduction |
Species | Rattus norvegicus (Rat) |
Source | Baculovirus |
Expression Region | 24-166aa |
Target Protein Sequence | IPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPTCVMKEKKRAGETFFMCSCNTEECNDYIIFNEEYTTSSPDLLLVIIQ Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 20.0 kDa |
Protein Length | Partial |
Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFRB1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways (By similarity). |
Subcellular Location | Cell membrane, Single-pass type I membrane protein, Membrane raft |
Protein Families | Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily |
Database Links |
KEGG: rno:81810 STRING: 10116.ENSRNOP00000035501 UniGene: Rn.164421 |
Recombinant Human Butyrophilin subfamily 3 member A2(BTN3A2),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Carbonyl reductase [NADPH] 1(CBR1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2),partial
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Myeloid leukemia factor 1(MLF1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Bovine Guanine nucleotide-binding protein G(t) subunit alpha-2(GNAT2)
Express system: E.coli
Species: Bos taurus (Bovine)
Recombinant Bovine Beta-1,4-galactosyltransferase 1(B4GALT1),partial
Express system: Yeast
Species: Bos taurus (Bovine)
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide