Purity
Greater than 90% as determined by SDS-PAGE.
Species
Ovis aries (Sheep)
Expression Region
30-208aa
Target Protein Sequence
GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Sheep IL6 contains amino acids 30-208. The calculated molecular weight for this IL6 protein is 47.5 kDa. Expression of this IL6 protein is conducted in e.coli. The IL6 gene fragment has been modified by fusing the N-terminal GST tag, providing convenience in detecting and purifying the recombinant IL6 protein during the following stages.
Sheep interleukin-6 (IL6), similar to its mammalian counterparts, is a multifunctional cytokine with diverse roles in immune regulation and inflammation. Produced by various cell types, including immune cells and fibroblasts, sheep IL6 is involved in mediating immune responses, hematopoiesis, and acute-phase reactions. It plays a crucial role in orchestrating the body's defense mechanisms during infections and tissue injuries. IL6 is also implicated in the regulation of metabolic processes and has been studied in the context of various diseases. Understanding the functions of sheep IL6 contributes to broader insights into the immune system of sheep and potential applications in veterinary medicine and livestock health management.
