Recombinant Sheep Interleukin-6(IL6)

In Stock
Code CSB-EP011664SH
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P29455
Lead Time 3-7 business days
Relevance Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hatopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Ovis aries (Sheep)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK
Source E.coli
Gene Names IL6
Expression Region 30-208aa
Tag Info N-terminal GST-tagged
Mol. Weight 47.5kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
References
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation (By similarity).
Subcellular Location Secreted
Protein Families IL-6 superfamily
Database Links

KEGG: oas:443406

UniGene: Oar.460

Pathway HIF-1 signaling pathway
Jak-STAT signaling pathway
PI3K-Akt signaling pathway
TNF signaling pathway
Cellular senescence
Hematopoietic cell lineage
IL-17 signaling pathway
NOD-like receptor signaling pathway
Th17 cell differentiation
Toll-like receptor signaling pathway
AGE-RAGE signaling pathway in diabetic complications
FoxO signaling pathway
Inflammatory Pain

Related Products

IL6 Antibodies

IL6 Antibodies for Ovis aries (Sheep)

IL6 Proteins

IL6 Proteins for Ovis aries (Sheep)

IL6 ELISA Kit

IL6 ELISA Kit for Ovis aries (Sheep)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.