Recombinant Mouse T-lymphocyte activation antigen CD80 (Cd80)

Code CSB-CF004959MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Cd80; B7; T-lymphocyte activation antigen CD80; Activation B7-1 antigen; CD antigen CD80
Species
Mus musculus (Mouse)
Expression Region
38-306
Target Protein Sequence
VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKNTLVLFGAGFGAVITVVVIVVIIKCFCKHRSCFRRNEASRETNNSLTFGPEEALAEQTVFL
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the costimulatory signal essential for T lymphocytes activation. T-cell proliferation and cytokine production is induced by the binding of CD28 or CTLA-4 to this receptor.
Gene References into Functions
  1. CD80 regulates Th17 differentiation in Coxsackie virus B3-induced acute myocarditis. PMID: 29039143
  2. The study showed an association between CD80 and bone mineral density and the risk of osteoporosis. PMID: 28466138
  3. this study shows that CD80 expressed by CD8(+) T cells contributes to PD-L1-induced apoptosis of activated CD8(+) T cells PMID: 29181416
  4. TNFalpha is a prominent mediator of renal CD80 induction and resultant albuminuria. PMID: 27125280
  5. findings do not support a role for B7-1 in podocyte biology PMID: 27528551
  6. PD-L1 interacts with CD80 to regulate graft-versus-leukemia activity of donor CD8+ T cells PMID: 28414296
  7. PD-1 receptor has a role in interacting with programmed cell death ligands and B7-1 PMID: 28270509
  8. Meningococcal capsular polysaccharide-loaded vaccine nanoparticles induce expression of CD80. PMID: 24981893
  9. The genetic inactivation of B7.1/B7.2 deteriorates obesity-related liver steatosis and metabolic dysregulation, likely a result of the intrinsic absence of Tregs in these mice, rendering DKO mice a novel murine model of NASH. PMID: 24845056
  10. These results indicate that B7H1/CD80 interaction augments Tcon cell proliferation, IL-2 production, and expression of PD-1, which leads to increased apoptosis PMID: 25488990
  11. demonstrates that the simultaneous silencing of CD40 and CD80 genes has synergistic effects in preventing allograft rejection, and may therefore have therapeutic potential in clinical transplantation PMID: 24886282
  12. data show an important role of the adaptive immune system, in particular T cell CD80/86 costimulation molecules, in the physiological regulation of bone resorption and preservation of bone mass PMID: 24807557
  13. CD80 and CD86 costimulatory molecules regulate OT-II CD4(+) T lymphocyte proliferation and cytokine response in cocultures with antigen-presenting cells derived from pregnant and pseudopregnant mice PMID: 24771983
  14. The need for additional immune suppression in the intestine reflects commensal microbe-driven T-cell activation through the accessory costimulation molecules ICOSL and OX40L in B7 deprived mice. PMID: 25002484
  15. demonstrate that subcategorizing memory B cells on the basis of their expression of CD80 and PD-L2 PMID: 24880458
  16. B7.1 and B7.2 molecules have equal ability to mediate host resistance to Mycobacterium tuberculosis. PMID: 24099792
  17. Data suggest that decitabine (DAC) induces CD80 expression in EL4 cells via demethylation of CpG dinucleotide sites in the promoter of CD80 gene. PMID: 23671644
  18. These studies identify CD80-Fc as an alternative and potentially more efficacious therapeutic agent for overcoming PDL1-induced immune suppression and facilitating tumor-specific immunity PMID: 23918985
  19. The activation of protective CD8 T cells requires positive B7-1/B7-2 costimulation even when suppression by Tregs and in particular, Treg-intrinsic CTLA-4 is circumvented. PMID: 23744647
  20. Macrophages from infected animals show increased expression of PDL2 and CD80 that was dependent from the sex of the host. PMID: 23533995
  21. Microglia thus isolated show high surface expression of CD11c together with the co-stimulatory molecules CD40, CD80, and CD86 that are necessary for T-cell activation. PMID: 23439211
  22. Blockade of B7-1/B7-2 in NOD.AireGW/+ mice results in fulminant, early-onset autoimmune peripheral neuropathy. PMID: 23487421
  23. Although CD70 is required for dendritic cell-mediated delay of T cell tolerance induction, CD80 and CD86 are necessary for refunctionalizing the tolerized T cells in prostate tumor tissue PMID: 22798683
  24. These data demonstrate, for the first time, that iTregs can acquire CD80 and CD86 from mDCs, and the acquisition of CD86 may enhance their suppressive function. PMID: 22307040
  25. Mixed bone marrow chimeras demonstrated a B cell-intrinsic requirement for CD80 expression for normal T(FH) cell and PC development PMID: 22450810
  26. Under influence of estrogen, expression of CD80 appears to be down-regulated during activation of B cells; that is, upon addition of 17beta-estradiol to cultured splenocytes, CD80 is down-regulated but IgG is up-regulated. PMID: 21726119
  27. B7-1 interactions with programmed death-1 ligand 1 (PD-L1) may be particularly important for regulating potentially pathogenic self-reactive effector T cells. PMID: 21697456
  28. B7-1 on stromal cells is a key molecule regulating IL-10 production by multifunctional Treg cells, HOZOT. PMID: 20628373
  29. Mice inoculated with H22 tumor cells expressing B7-1, B7-2 and 4-1BBL developed a strong cytotoxic T lymphocyte response and long-term immunity against wild-type tumor, suggesting a synergistic effect between the B7 and 4-1BBL costimulatory pathways PMID: 20563597
  30. A new immune regulation loop is revealed consisting of T cell-derived interferon-gamma, B7H1 expression by antigen-presenting cells, and B7.1 expression by regulatory T (Treg) cells in an autoimmune-like graft-versus-host disease model. PMID: 21263067
  31. Peripheral regulatory T-cell maintenance critically depends on the presence of classical dendritic cells expressing CD80/86. PMID: 21267999
  32. inhibition of PU.1 expression by short interfering RNA in bone marrow-derived dendritic cells resulted in marked down-regulation of CD80 and CD86 expression PMID: 21119111
  33. T cell-expressed CD80, more so than CD86, plays an important role in limiting expansion of effector CD8-positive cytotoxic T lymphocytes. PMID: 21115734
  34. These data reveal a requirement for B7-mediated signaling in regulating the CMV-specific CD4 T cell response and establishing host-virus equilibrium. PMID: 20980516
  35. In the absence of CD80/86, CD4 T cell priming was intact but secondary responses to intranasal administration of vaccinia virus were reduced. PMID: 21040905
  36. T-cell costimulation via B7 ligands CD80 and CD86 is essential for development of experimental hypertension; inhibition of this process could have therapeutic benefit in the treatment of this disease. PMID: 21126972
  37. The interaction of CTLA4 and B7 inhibits T helper cell type (Th)17 differentiation in vitro and in vivo and suppresses Th17-mediated autoimmunity. Blocking the CTLA4-B7 interaction potentiates Th17 cell differentiation in vitro and in vivo. PMID: 20601598
  38. These results provide evidence that signaling delivered by B7-1 and B7-2 plays a role in determining the outcome of group B streptococcal induced arthritis, likely due to the different local secretory pattern. PMID: 20114085
  39. Covalently linked dimers of B7-1 mediate strong and persistent early events in T cell-antigen presenting cell interaction and T cell activation. PMID: 20065109
  40. B7-1 and B7-2, but not PD-L1 and PD-L2, on IL-10-treated DC and DC-derived exosomes play a critical role in immunosuppressive functions of both DC and exosomes. PMID: 19757438
  41. Direct signaling through B7-1 and B7-2 is identified as a potent regulator of IgG secretion by previously activated B cells. PMID: 19933871
  42. upregulation of CD80 and loss of constitutive CD86 expression on monocytes was associated with higher severity of illness and inflammation confirming the findings in our mouse model PMID: 19672303
  43. Negative effect of CTLA-4 on induction of T-cell immunity in vivo to B7-1+, but not B7-2+, murine myelogenous leukemia. B7-1 was important for the induction of CD8+ T-cell immunity in the absence of CTLA-4. PMID: 11877291
  44. Simultaneous expression of allogenic class II MHC and B7.1 (CD80) molecules in A20 B-lymphoma cell line enhances tumor immunogenicity. PMID: 11911464
  45. B7-CTLA4 interaction promotes cognate destruction of tumor cells by cytotoxic T lymphocytes in vivo. B7-CD28 interaction enhances T-cell clonal expansion. PMID: 11929778
  46. CD80 is important in mediating a down-regulatory effect on CD8+ CTL development, perhaps through preferential binding to CTLA4. PMID: 11937530
  47. B7-1 in deleting pathogenic autoreactive T cells in the thymus. PMID: 11956287
  48. distinct differences in the ability of LT and LT (E112K) to enhance B7-1 and B7-2 on APC, as well as a dependence upon these costimulatory molecules for their adjuvant properties PMID: 12165495
  49. findings indicate that B7-1a, an alternatively spliced form of B7-1, serves as a more efficacious costimulatory molecule than B7-1 or B7-2 in the induction and maintenance of anti-tumor immune responses against a poorly immunogenic osteosarcoma cell line PMID: 12174878
  50. Differential effects of iron deficiency on the expression of CD80 and CD86 co-stimulatory receptors in mitogen-treated and untreated murine spleen cells PMID: 12210763

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed on activated B-cells, gamma interferon stimulated monocytes and non-circulating B-cell malignancies.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1