Recombinant Human Insulin-like growth factor I protein(IGF1) (Active)

In Stock
Code CSB-AP002561HU
Product Type Growth Factor
Size US$49Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P05019
Image
Storage Buffer 0.2 μm filtered 20 mM PB, pH 7.2 ,lyophilized
Alias IGF-I, MGF, Somatomedin-C
Species Homo sapiens (Human)
Biological_Activity Fully biologically active when compared to standard. The ED50 as determined by the stimulation of protein synthesis using rat L6 myoblasts is less than 10 ng/ml, corresponding to a specific activity of >1.0x105 IU/mg.
Purity >90% as determined by SDS-PAGE and HPLC.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Research Area Cancer
Source E.Coli
Gene Names IGF1
Expression Region MFPAMPLSSLFVN+49–118aa( E51R)
Tag Info Tag-Free
Mol. Weight 9.1 kDa
Protein Description Full Length of Mature Protein
PubMed ID 6358902; 3002851; 2935423; 2937782; 3455760; 2082190; 2018498; 1372070; 8495408; 16541075; 15489334; 6382022; 632300; 3242681; 21076856; 24132240; 6189745; 2036417; 1319992; 8857020; 10391209
Still Have Questions? Leave a Message or Start an on-line Chat
Function The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation
Involvement in disease Insulin-like growth factor I deficiency (IGF1 deficiency)
Subcellular Location Secreted
Protein Families Insulin family
Database Links

HGNC: 5464

OMIM: 147440

KEGG: hsa:3479

STRING: 9606.ENSP00000302665

UniGene: Hs.160562

Pathway HIF-1 signaling pathway
MAPK signaling pathway
mTOR signaling pathway
p53 signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Ras signaling pathway
Signaling pathways regulating pluripotency of stem cells
AMPK signaling
FoxO signaling pathway
Rap1 signaling pathway

Related Products

IGF1 Antibodies

IGF1 Antibodies for Human

IGF1 Antibodies for Homo sapiens (Human)

IGF1 ELISA Kit

IGF1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.