Recombinant Human Insulin-like growth factor I(IGF1)

In Stock
Code CSB-EP356436HUe0
Product Type Recombinant Protein
Size US$1726
Uniprot No. P05019
Relevance The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP065544h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IGF1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP065544h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IGF1.
Storage Buffer Tris-based buffer,50% glycerol
Alias Mechano growth factor ;MGFSomatomedin-C
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Source E.coli
Gene Names IGF1
Expression Region 49-118aa
Tag Info N-terminal GST-tagged
Mol. Weight 34.7kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation
Involvement in disease Insulin-like growth factor I deficiency (IGF1 deficiency)
Subcellular Location Secreted
Protein Families Insulin family
Database Links

HGNC: 5464

OMIM: 147440

KEGG: hsa:3479

STRING: 9606.ENSP00000302665

UniGene: Hs.160562

Pathway HIF-1 signaling pathway
MAPK signaling pathway
mTOR signaling pathway
p53 signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Ras signaling pathway
Signaling pathways regulating pluripotency of stem cells
AMPK signaling
FoxO signaling pathway
Rap1 signaling pathway

Related Products

IGF1 Antibodies

IGF1 Antibodies for Human

IGF1 Antibodies for Homo sapiens (Human)

IGF1 ELISA Kit

IGF1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.