Recombinant Human Interleukin-6(IL6),partial (Active)

In Stock
Code CSB-AP004301HU
Product Type Interleukin
Size $153Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P05231
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm Filtered 20 mM HAc-NaAc, 150 mM NaCl, pH 5.0
Alias Interleukin-6; IL-6; B-Cell Stimulatory Factor 2; BSF-2; CTL Differentiation Factor; CDF; Hybridoma Growth Factor; Interferon Beta-2; IFN-Beta-2; IL6; IFNB2
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 1 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Research Area Immunology
Source E.coli
Gene Names IL6
Expression Region 29-212aa
Tag Info Tag-Free
Mol. Weight 20.9 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation.
Involvement in disease Rheumatoid arthritis systemic juvenile (RASJ)
Subcellular Location Secreted
Protein Families IL-6 superfamily
Database Links

HGNC: 6018

OMIM: 147620

KEGG: hsa:3569

STRING: 9606.ENSP00000258743

UniGene: Hs.654458

Pathway HIF-1 signaling pathway
Jak-STAT signaling pathway
PI3K-Akt signaling pathway
TNF signaling pathway
Cellular senescence
Hematopoietic cell lineage
IL-17 signaling pathway
NOD-like receptor signaling pathway
Th17 cell differentiation
Toll-like receptor signaling pathway
AGE-RAGE signaling pathway in diabetic complications
FoxO signaling pathway
Inflammatory Pain

Related Products

IL6 Antibodies

IL6 Antibodies for Homo sapiens (Human)

IL6 Antibodies for Human

IL6 Proteins

IL6 Proteins for Homo sapiens (Human)

IL6 ELISA Kit

IL6 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.