Recombinant Human B-cell antigen receptor complex-associated protein alpha chain (CD79A), partial (Active)

In Stock
Code CSB-MP004957HU1
Abbreviation Recombinant Human CD79A protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CD79A at 2 μg/ml can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC50 is 1.521-1.700 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD79A at 2 μg/mL can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC50 is 1.521-1.700 ng/mL.
Target Names
Uniprot No.
Alternative Names
B-cell antigen receptor complex-associated protein alpha chain; Ig-alpha;MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD79a
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
33-143aa
Target Protein Sequence
LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR
Mol. Weight
14.0 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human CD79A protein is a human fragment protein that contains the 33-143 aa and is synthesized in mammalian cells. It carries a 10xHis tag at the C-terminus. The purity of the CD79A protein is over 90% as confirmed by SDS-PAGE. Its biological activity is assessed through a functional ELISA, where immobilized human CD79A at 2 μg/mL successfully binds to the anti-CD79A recombinant antibody (CSB-RA004957MA1HU), with an EC50 value ranging from 1.521 to 1.700 ng/mL.

The CD79A protein is a crucial B-cell receptor (BCR) signaling pathway component. It is primarily expressed in B lymphocytes and is essential in B-cell development, activation, and function. CD79A forms a heterodimer with CD79B, and together they are integral to the signaling mechanisms that activate B cells upon antigen recognition, which is vital for the adaptive immune response [1][2][3].

In the context of immune responses, CD79A is involved in tonic signaling, which is necessary for the survival and maturation of B cells. This signaling is critical during the transition of precursor B cells into mature follicular B cells, highlighting the importance of CD79A in early B-cell development [4]. Furthermore, CD79A expression has been linked to various clinical outcomes in cancers, particularly in breast cancer, where its expression correlates with a higher density of tumor-infiltrating lymphocytes (TILs) and improved patient survival rates in triple-negative breast cancer [5][6].

Moreover, CD79A has been implicated in the pathogenesis of several hematological malignancies, including classical Hodgkin's lymphoma and plasma cell myeloma, where its expression levels can affect disease progression and treatment responses [1][7]. In studies involving immune responses, CD79A has been shown to interact with various immune cells, influencing the overall humoral immune response and potentially modulating the effects of therapies such as BCG in bladder cancer [8][9].

References:
[1] S. Wang. Machine learning reveals diverse cell death patterns in lung adenocarcinoma prognosis and therapy, NPJ Precision Oncology, vol. 8, no. 1, 2024. https://doi.org/10.1038/s41698-024-00538-5
[2] Y. Feng, J. Hurst, M. Almeida-De-Macedo, X. Chen, L. Li, N. Ransom, et al. Massive human co‐expression network and its medical applications, Chemistry & Biodiversity, vol. 9, no. 5, p. 868-887, 2012. https://doi.org/10.1002/cbdv.201100355
[3] Q. Feng, W. Qin, & Y. Zang. Molecular mechanism of triple‑negative breast cancer‑associated brca1 and the identification of signaling pathways, Oncology Letters, 2019. https://doi.org/10.3892/ol.2019.9884
[4] X. Huang, K. Takata, Y. Sato, T. Tanaka, K. Ichimura, M. Tamura, et al. Downregulation of the b‐cell receptor signaling component cd79b in plasma cell myeloma: a possible post transcriptional regulation, Pathology International, vol. 61, no. 3, p. 122-129, 2011. https://doi.org/10.1111/j.1440-1827.2010.02634.x
[5] Y. Lv. Differential whole-genome doubling based signatures for improvement on clinical outcomes and drug response in patients with breast cancer, Heliyon, vol. 10, no. 7, p. e28586, 2024. https://doi.org/10.1016/j.heliyon.2024.e28586
[6] T. Velazquez-Caldelas. Coordinated inflammation and immune response transcriptional regulation in breast cancer molecular subtypes, Frontiers in Immunology, vol. 15, 2024. https://doi.org/10.3389/fimmu.2024.1357726
[7] C. He, S. Wang, C. Zhou, M. He, J. Wang, M. Ladds, et al. Cd36 and lc3b initiated autophagy in b cells regulates the humoral immune response, Autophagy, vol. 17, no. 11, p. 3577-3591, 2021. https://doi.org/10.1080/15548627.2021.1885183
[8] B. Ravenscroft. Increased stromal densities of b cells, cd103+ cells, and cd163+ m2-like macrophages associate with poor clinical outcomes in bcg treated non-muscle invasive bladder cancer,, 2023. https://doi.org/10.1101/2023.10.19.562817
[9] H. Hu. A breast cancer classification and immune landscape analysis based on cancer stem-cell-related risk panel, NPJ Precision Oncology, vol. 7, no. 1, 2023. https://doi.org/10.1038/s41698-023-00482-w
[10] L. Tribolet, C. Cantacessi, D. Pickering, S. Navarro, D. Doolan, A. Trieu, et al. Probing of a human proteome microarray with a recombinant pathogen protein reveals a novel mechanism by which hookworms suppress b-cell receptor signaling, The Journal of Infectious Diseases, vol. 211, no. 3, p. 416-425, 2014. https://doi.org/10.1093/infdis/jiu451

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.
Gene References into Functions
  1. The incidence of MYD88 and CD79B mutations in patients with CD5(+) DLBCL is lower than that in patients with DLBCL-SS, suggesting that CD5(+) DLBCL is not the same disease as DLBCL-SS in terms of gene mutation status. PMID: 27915469
  2. Phosphorylation of CD79a causes a decrease in helical propensity in the C-terminal region, for CD79b, the opposite was observed and phosphorylation resulted in an increase of helical propensity in the C-terminal part. PMID: 24769851
  3. High intensity of caries is associated with increased levels of some salivary components - sIgA, histatin-5 and lactoperoxidase. PMID: 24974109
  4. CD79a plays a functional role in the tumor promoting effects of myeloid cells, and may represent a novel target for cancer therapy. PMID: 24146823
  5. STN produced significant antitumor effects in a mouse xenograft model of CD79A/B-mutated DLBCL. PMID: 21324920
  6. CD79a may be helpful marker in the differential diagnosis of classical Hodgkin's lymphoma and primary mediastinal B-cell lymphoma PMID: 20102401
  7. Unlike the B29 octamer motif, the mb-1 octamer motif does not have the essential sequence required for OBF-1/Bob1 interaction, therefore its promoter is not transactivated by OBF-1/Bob1. PMID: 11907094
  8. B cell-restricted mb-1 gene: expression, function, and lineage infidelity. Review. PMID: 12403343
  9. There is a somatic hypermutation of this gene in B-cell lymphoma and multiple myeloma. PMID: 12651942
  10. Results indicate that PAX5 is a more specific marker than CD79a for B-cell ALL diagnosis. PMID: 15492262
  11. lower levels of B-cell receptor surface expression observed in chronic lymphocytic leukemia are accounted for by an impaired glycosylation and folding of the mu and CD79a chains. PMID: 15591116
  12. FISH findings indicate that CD79a, despite its specificity for B-cell differentiation, represented the aberrant presence of a B-cell antigen in leukemias of distinct myeloid linage. PMID: 16271957
  13. Acute leukemia with t(8;21) coexpresses CytCD79a represent biphenotypic acute leukemia. PMID: 17350472
  14. Anti-CD79b antibodies downregulated surface B-cell receptor and were trafficked to the lysosomal-like major histocompatibility complex class II-positive compartment of a mouse xenograft model of non-Hodgkin lymphoma. PMID: 17374736
  15. Ig-alpha was phosphorylated in all myeloma IgG BCR isolates, the 31-kD variant being phosphorylated most frequently. It was not phosphorylated in normal control B cells. PMID: 17701175
  16. Median survival time of cytoplasmic CD79 alpha positive group was shorter than that of cytCD79a negative group in acute myeloid leukemia. PMID: 18160827

Show More

Hide All

Involvement in disease
Agammaglobulinemia 3, autosomal recessive (AGM3)
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
B-cells.
Database Links

HGNC: 1698

OMIM: 112205

KEGG: hsa:973

STRING: 9606.ENSP00000221972

UniGene: Hs.631567

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*