Recombinant Human Insulin-like growth factor I (IGF1) (E51R) (Active)

In Stock
Code CSB-MP356436HU-WD
Abbreviation Recombinant Human IGF1 protein (E51R) (Active)
MSDS
Size Inquiry
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
≤10 EU/mg by the LAL method
Activity
Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect ≤1.5 ng/mL.
Target Names
LR3 IGF1
Uniprot No.
Alternative Names
Insulin-Like Growth Factor I; IGF-I; Mechano Growth Factor; MGF; Somatomedin-C; IGF1; IBP1
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
MFPAMPLSSLFVN+49-118aa(E51R)
Target Protein Sequence
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Mol. Weight
9.0 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag free
Form
Lyophilized
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation. Ca(2+)-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb. Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV:ITGB3 and ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1.
Gene References into Functions
  1. SNX6 knockdown resulted in a dramatic diminution of IGF1-mediated ERK1/2 phosphorylation, but did not affect IGF1R internalization. PMID: 29530981
  2. We found that elevated production of insulin-like growth factor 1 by polyploid ASCs rendered them more potent in tumor growth promotion in vitro. PMID: 30185144
  3. No up-regulation of Wnt10A and IGF-1 mRNA was observed with 1,550-nm Er:Glass fractional laser treatment of androgenetic alopecia. PMID: 30096107
  4. Significant negative or positive correlations were observed between IGF-1 concentrations and impairments on several EDI-2 subscales (drive for thinness, body dissatisfaction, interoceptive awareness, sense of ineffectiveness, interpersonal distrust, maturity fear) and on SCL-90 subitems (depression, hostility, obsessivity compulsivity, anxiety), suggesting a possible hormonal modulatory effect on specific aspects of eatin PMID: 29179911
  5. This article reviews the tumor-specific molecular signatures of IGF-1-mediated epithelial-mesenchymal transition in breast, lung, and gastric cancers. [review] PMID: 30111747
  6. Results provide evidence for the role of IGF-I: matrix protein interactions in cell growth, migration and melanoma progression through forming a complex with IGF binding proteins. PMID: 29330502
  7. The molecular interactions of IGF1-IGF1R binding have been dissected. PMID: 29483580
  8. genetic association and nutrigenomic studies in population of postmenopausal women in China: Data confirm that dietary acid load is associated with postmenopausal osteoporosis; an SNP in IGF1 (rs35767) is not associated with this relationship in the population studied. PMID: 30018240
  9. Low IGF-I levels are associated with non-alcoholic fatty liver disease. PMID: 29395967
  10. Low IGF1 expression is associated with retinopathy of prematurity. PMID: 29274846
  11. Low IGF-I levels are associated with dry eye syndrome. PMID: 29452886
  12. serum IGF-1 is associated with more muscle mass, higher bone mineral density, and better handgrip performance in both genders among community-dwelling middle aged and older adults in Taiwan PMID: 28351218
  13. insulin-like growth factor 1 (IGF1) is a direct target of miR-1827. PMID: 28387248
  14. Results found that the expression of IGF-1 was up-regulated in cumulus cells (CCs) of women with polycystic ovary syndrome (PCOS), which was inversely proportional to the expression level of miR-323. Also, IGF1 3'UTR is targeted by miR-323. PMID: 30300681
  15. Study in hepatocellular carcinoma cell line elicited a new mechanism in which IGF-1 induced epithelial-mesenchymal transition through regulation of survivin and a downstream pathway. PMID: 29989646
  16. in this study, the influence of IGF-1 and BMP-7 in different concentrations on the osteogenic differentiation of two human MSC-subtypes, isolated from reaming debris (RMSC) and iliac crest bone marrow (BMSC) has been assessed PMID: 29874864
  17. AMH, IGF1 and leptin levels in follicular fluid have no relation to the fertility disorders caused by endometriosis or fallopian tube damage, though they are biomarkers for anovulatory fertility disorders. PMID: 29595066
  18. pituitary growth hormone secretory capacity is not related to the IGF-1 levels PMID: 29098662
  19. Peripheral totalIGF-1 and IGFBP-3 were associated with better performance in attention, visuospatial, and global cognitive domains, independent of the gait speed. PMID: 29547749
  20. CA repeat polymorphism of the P1 promoter of the IGF1 gene was associated with strength predispositions in the homozygous and non-carriers groups. In the group who were heterozygous it was speed-strength aptitudes. PMID: 29543920
  21. IGF1 levels in systemic lupus erythematosus patients decline with age at a similar rate as in healthy controls, are associated with positive metabolic effects and despite a moderating effect on B, NK and CD8+ cells, do not affect clinical disease activity or severity. PMID: 29385899
  22. results indicate that IGF-1 gene polymorphisms play crucial roles in the histopathological progression of IgA Nephropathy in the Chinese Han population PMID: 29402846
  23. Low IGF1 level is associated with steatosis in Pituitary Diseases. PMID: 29065431
  24. They retained the main IGF-1R-related properties, but the hormones with His49 in IGF-1 and His48 in IGF-2 showed significantly higher affinities for IR-A and for IR-B, being the strongest IGF-1- and IGF-2-like binders of these receptors ever reported. PMID: 29608283
  25. Mechanism of activation of SGK3 by IGF1 via the class 1 and class 3 phosphatidylinositol 3-kinases has been described. PMID: 29150437
  26. IGF1 is associated with giant cell tumor of bone recurrence, which might serve as biomarker for giant cell tumor of bone recurrence PMID: 29651441
  27. miR-19b is decreased in PCOS granulosa cells and miR-19b could be a granulosa cell proliferation inhibitor. miR-19b-mediated cell proliferation may act via directly targeting IGF-1. PMID: 29363717
  28. Report deregulation of IGF1/IGFBP3 expression in breast cancer correlating with neoplasm staging and histologic grade. PMID: 30084561
  29. Study observed that the IGF1 level was higher in human epithelial ovarian cancer (EOC) specimens than that in benign ovarian tumor specimens, and further analysis showed that a higher level of IGF1 was related to more advanced clinical stage and liver metastasis. Also, up-regulation of IGF1 by tumor-associated macrophages was shown to promote the proliferation and migration of EOC cell lines. PMID: 29251331
  30. Overexpression of circHIPK3 increased the expression levels of IGF1 and knock-down reduced it. PMID: 28738961
  31. 0001) only. Women who remained obese had increased cGP/IGF-1 ratio (p = 0.006) only. Increase in cGP/IGF-1 ratio is associated with obesity, but not hypertension. Changes of IGFBP-3 and/or cGP/IGF-1 ratio are associated with weight changes. The data suggest the role for cGP in obesity through autocrine regulation of IGF-1. PMID: 29921371
  32. IGF-1 exerts antioxidant, anti-inflammatory and protective effects on the central nervous system. (Review) PMID: 29975480
  33. Five single nucleotide polymorphisms (SNPs) of IGF-1 (rs6214, rs6218, rs35767, rs5742612, and rs5742714) were genotyped. DNA was extracted from peripheral blood and analyzed for SNP genotyping using PCR. rs6218 had a predictive role for the susceptibility and progression of osteosarcoma. The TC and CC genotypes of rs6218 indicated higher risk of osteosarcoma; associated with later stage and elevated risk of osteosarcoma PMID: 29232358
  34. Bio informatics analysis of 982 lung cancer patients revealed that higher expression of TNF- alpha was associated with low risk of cancer progression while overexpression of IGF-1 was correlated with high risk. Collectively, these results reveal that the cytokines in the tumor microenvironment differentially modulate radiation therapy through a variety of signaling mechanisms. PMID: 27344406
  35. Data suggest that lower IGF1 serum levels in aging are associated with lower handgrip strength and worse physical performance, but less recurrent falls, especially in men. This longitudinal study was conducted in the Netherlands. PMID: 29789408
  36. Data suggest that R1353H point mutation constitutes an activating IGF1R variant that can result in extreme tall height with very low levels of serum IGFI; the mutation was observed in proband, his mother, and his 3 sons, however, only the proband (43 y/o) and eldest son (18 y/o) exhibit extreme tall height. [CASE REPORT] PMID: 29789409
  37. IGF-1 treatment activated protein kinase B (AKT), which may inhibit autophagy via the AKT/mammalian target of rapamycin signaling pathway. Following inhibition of autophagy, drug resistant cells became sensitive to apoptosis induced by 5-fluorouracil. PMID: 29257307
  38. Consistent with its enhanced expression in Laron syndrome, we provide evidence that TXNIP gene expression is negatively regulated by IGF1. PMID: 29339473
  39. In elderly women with low-energy distal radius fractures, an association between IGF1 and lowest measures of bone mineral density was found, indicating that low IGF1 could be an indirect risk factor for fractures. PMID: 29178313
  40. Expression of miR-30a-3p was significantly increased in the placentas of patients with preeclampsia. miR-30a-3p might be involved in the pathogenesis of preeclampsia by targeting IGF-1 and regulating the invasion and apoptosis of trophoblast cells. PMID: 29155142
  41. results suggest that the different isoforms of the PI3K p110 subunit could be therapeutic targets for primary and metastatic colon cancer and that regulation of the NRD1/ADAM signaling pathway controls lipogenesis-mediated EMT in IGF-1-stimulated colon cancer cells. PMID: 28819788
  42. Demonstrate the uptake of fluorescently labeled IGF-I into skeletal growth plates of live mice using multiphoton microscopy. PMID: 28798204
  43. Study provides evidence that IGF-1/IGF-1R/hsa-let-7c axis can control the odonto/osteogenic differentiation of IGF-1-treated stem cells from apical papilla via the regulation of JNK and p38 MAPK signaling pathways. PMID: 27833148
  44. Circulating sex steroids, prolactin, insulin-like growth factor (IGF) I, IGF-binding protein 3, and sex hormone-binding globulin (SHBG) were evaluated using backward elimination separately in women pre- and postmenopausal at blood collection. PMID: 28246273
  45. association between serum IGFBP-1 and IGF-I levels with advanced fibrosis in non-alcoholic fatty liver disease patients PMID: 28927302
  46. findings suggest that the IGF1 polymorphism rs5742714 may be a genetic predictor of susceptibility and prognosis of renal cell carcinoma. PMID: 27976731
  47. The results of the study may help to inform future health interventions that utilize physical activity as a means to improve cognitive development in children, adolescents, and adults. Additionally, the study may assist in determining whether the putative effects occur via modification of plasma IGF-1 or BDNF concentrations. PMID: 29094050
  48. Data show the differential expression of insulin like growth factor 1 (IGF-I) transcripts isoforms in bladder cancer, revealing a distinct suppression of IGF-IEc. PMID: 29848696
  49. Peripheral blood aspirates overexpressing IGF-I via rAAV gene transfer undergo enhanced chondrogenic differentiation processes. PMID: 28467017
  50. Human IGF-I propeptides and mutants were overexpressed in bovine articular chondrocytes. Secreted IGF-I propeptides stimulated articular chondrocyte biosynthetic activity as much as mature IGF-I. Of the 3 IGF-I propeptides, only proIGF-IA strongly bound to heparin, depending on N-glycosylation at Asn92 in the EA peptide. PMID: 29174671

Show More

Hide All

Involvement in disease
Insulin-like growth factor I deficiency (IGF1 deficiency)
Subcellular Location
Secreted.
Protein Families
Insulin family
Database Links

HGNC: 5464

OMIM: 147440

KEGG: hsa:3479

STRING: 9606.ENSP00000302665

UniGene: Hs.160562

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*