Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Anti-TNFRSF17 recombinant antibody (CSB-RA023974MA1HU). The EC50 is 5.652-7.215 ng/mL.
②Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Anti-TNFRSF17 recombinant antibody (CSB-RA023974MA3HU). The EC50 is 2.296-2.754ng/mL.
③Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Anti-TNFRSF17 recombinant antibody (CSB-RA023974MA4HU). The EC50 is 14.97-19.19 ng/mL.
④Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Human TNFSF13 protein (CSB-MP023989HU). The EC50 is 4.217-5.674 ng/mL.
⑤Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Human TNFSF13B protein (CSB-MP897523HU1). The EC50 is 4.346-5.534 ng/mL.
Alternative Names
B-cell maturation protein (CD_antigen: CD269)(BCM) (BCMA)
Species
Homo sapiens (Human)
Target Protein Sequence
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.