Recombinant Dog Tumor necrosis factor (TNF)

Code CSB-YP023955DO
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP023955DO
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP023955DO-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP023955DO
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP023955DO
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
TNF; TNFA; TNFSF2; Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a) [Cleaved into: Tumor necrosis factor; membrane form; N-terminal fragment; NTF); Intracellular domain 1; ICD1); Intracellular domain 2; ICD2); C-domain 1; C-domain 2; Tumor necrosis factor; soluble form]
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Expression Region
57-233
Target Protein Sequence
GPQREELPNGLQLISPLAQTVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANG VELTDNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSP CQRETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIAL
Protein Length
Extracellular domain
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6.; The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
Gene References into Functions
  1. two SNPs of the TNF gene are associated with obesity in Labrador dogs PMID: 26692319
  2. Fatal outcome from pulmonary hemorrhages in dogs with leptospirosis was associated with low TNF-alpha, high IL-1beta, and high iNOS expression. PMID: 26824356
  3. This diminished TNF-alpha, IL-6 and iNOS expression, and NO production was in parallel to the respective decreased NF-kappaB p65 protein nuclear translocation in the LPS-activated canine PBMCs pretreated with 25 microM and 50 microM propofol. PMID: 25312048
  4. Tumour necrosis factor (TNF)-alpha expression was observed in vascular endothelial cells in both neoplastic and normal kidney. PMID: 22300704
  5. The observed HMGB1 release kinetics showed a clearly time-dependent manner with a peak release 24h after TNF-alpha stimulation, while stimulation with IFN-gamma had only small effects on the HMGB1 release. PMID: 22154216
  6. the TNF-alpha-induced activation of the ERK/GEF-H1/RhoA pathway in tubular cells is mediated through Src- and TACE-dependent EGFR activation. PMID: 21212278
  7. The replication characteristics of H3N8 influenza virus and its effects on protein expression of canine alveolar macrophages are reported; only TNF-alpha levels were significantly increased 12 h after inoculation. PMID: 19605916
  8. Inflammatory cytokines and NO may be involved in intraneural inflammatory changes arising from mechanical compression PMID: 16022989
  9. mRNA and protein structures and identities of the present known mammalian TNFA. PMID: 17573384
  10. findings suggest that susceptibility to Anal furunculosis in German Shepherd dogs is primarily associated with DLA-DRB1*00101 and any association with the Tumor Necrosis Factor-alpha locus is secondary and is because of linkage disequilibrium . PMID: 19254251
  11. the ERK/GEF-H1/Rho/Rho kinase/phospho-MLC pathway is the mechanism mediating TNF-alpha-induced elevation of tubular epithelial permeability, which in turn might contribute to kidney injury PMID: 19261619
  12. The usefulness of HSP27, HSP70, and TNF-alpha as biological markers for canine skin diseases was studied. PMID: 19578946

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, membrane form]: Membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, soluble form]: Secreted.; [C-domain 1]: Secreted.; [C-domain 2]: Secreted.
Protein Families
Tumor necrosis factor family
Database Links

KEGG: cfa:403922

STRING: 9615.ENSCAFP00000000739

UniGene: Cfa.54

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1