Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

BCL2

Uniprot No.

P10415

Research Area

Others

Alternative Names

BCL2; Apoptosis regulator Bcl-2

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

2-211aa

Target Protein Sequence

AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

25.2 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Our recombinant human apoptosis regulator BCL2 is co-expressed with a C-terminal 10xHis-tag in E. coli. It covers the 2-211aa of the human BCL2. Its purity level exceeds 85% confirmed by SDS-PAGE. It is available in liquid or lyophilized powder form. This recombinant BCL2 protein is ideally suited for apoptosis-related research, offering high-quality performance in various experimental applications.

The BCL2 protein is a critical regulator of apoptosis, functioning primarily as an anti-apoptotic factor. BCL2 is predominantly localized in the outer mitochondrial membrane but is also found in the nuclear and endoplasmic reticulum membranes [1]. Its primary function is to prevent the release of cytochrome c from mitochondria, a key event that triggers the apoptotic cascade. BCL2 achieves this by regulating the permeability of the mitochondrial membrane and interacting with other BCL2 family proteins, such as BAX and BAK, which promote apoptosis [2]. The overexpression of BCL2 can lead to cancer development, as it allows malignant cells to evade apoptosis [1][3]. This is particularly evident in various lymphomas, where BCL2 translocations are commonly observed, such as in follicular lymphoma [4].

References:
[1] K. Hwang, W. Han, J. Kim, H. Moon, S. Oh, Y. Song, et al., Prognostic influence of bcl2 on molecular subtypes of breast cancer, Journal of Breast Cancer, vol. 20, no. 1, p. 54, 2017. https://doi.org/10.4048/jbc.2017.20.1.54
[2] F. Llambi, T. Moldoveanu, S. Tait, L. Bouchier‐Hayes, J. Temirov, L. McCormicket al., A unified model of mammalian bcl-2 protein family interactions at the mitochondria, Molecular Cell, vol. 44, no. 4, p. 517-531, 2011. https://doi.org/10.1016/j.molcel.2011.10.001
[3] J. Gao, Q. Liu, Y. Xü, X. Gong, R. Zhang, C. Zhou, et al., Pparα induces cell apoptosis by destructing bcl2, Oncotarget, vol. 6, no. 42, p. 44635-44642, 2015. https://doi.org/10.18632/oncotarget.5988
[4] J. Iqbal, W. Sanger, D. Horsman, A. Rosenwald, D. Pickering, B. Davé, et al., Bcl2 translocation defines a unique tumor subset within the germinal center b-cell-like diffuse large b-cell lymphoma, American Journal of Pathology, vol. 165, no. 1, p. 159-166, 2004. https://doi.org/10.1016/s0002-9440(10)63284-1

Related Products

Target Background

Function

Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function. May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release.

Gene References into Functions

long noncoding RNA HOTAIR suppresses TNF-alpha induced nucleus pulposus cell apoptosis by regulating miR-34a/Bcl-2 axis. PMID: 30138895
The mitochondrial depolarization also stems from the Bcl-2 inhibition mediated by DFMT, followed by the cytochrome c release that activates caspase signaling. With the participation of the two-pronged mechanism, a programmed apoptosis is induced in response to DFMT treatment. PMID: 28805013
miR-7-5p reduced energy consumption via inhibiting PARP-1 expression, and miR-7-5p increased energy generation by suppressing the expression of Bcl-2. PMID: 30219819
Venetoclax-based combination treatment for newly diagnosed elderly patients for whom intense chemotherapy is not an option may be the first setting in which this agent may be employed in Acute myeloid leukemia. Based on pre-clinical evidence, BCL-2 inhibition may be useful in relapsed/refractory disease in conjunction with cytotoxic therapy, but has modest single agent activity. PMID: 29264938
Glandular, menopause-independent DFF40, DFF45, and Bcl-2 overexpression may play an important role in the pathogenesis of endometrial polyps and benign endometrial hyperplasia PMID: 28914671
data strongly suggest that XIAP-mediated inhibition of final caspase-3 processing is the last and major hurdle in TRAIL-induced apoptosis in NCI-H460 cells, which can be overcome by Smac in a Bcl-2 level dependent manner. PMID: 29927992
could not find any relationship between Bcl-2, c-Myc and EBER-ISH positivity and the low/high IPS groups in classical Hodgkin lymphoma PMID: 29708579
Fluorescence in situ hybridization studies (histologic sections) confirmed translocations of MYC (8q24), BCL2 (18q21) and BCL6 (3q27) in all patients. PMID: 30043475
High BCL-2 expression is associated with colorectal cancer. PMID: 30015962
MiR-29a down-regulation is correlated with drug resistance of nasopharyngeal carcinoma cell line CNE-1 and MiR-29a up-regulation decreases Taxol resistance of nasopharyngeal carcinoma CNE-1 cells possibly via inhibiting STAT3 and Bcl-2 expression. PMID: 29914005
Results revealed that BCL-2 protein is highly expressed in colon cancer tissues and was identified as a direct target for mir-184. BCL-2 appeared to participate in cell cycle regulation and malignant transformation to colon cancer. PMID: 28782841
Results indicate that full-length B-cell leukemia 2 family protein (Bcl-2) Ile14Gly/Val15Gly displayed severely reduced structural stability and a shortened protein half-life. PMID: 29131545
Data show the regulation of BCL2 mainly associated with methylation across the molecular subtypes of breast cancer. Luminal A and B subtypes showed upregulated expression of BCL2 protein, mRNA, and hypomethylation. Although copy number alteration may have played a minor role, mutation status was not related to BCL2 regulation. Upregulation of BCL2 was associated with better prognosis than downregulation of BCL2. PMID: 28701032
c-MYC/BCL2 protein co-expression in non-germinal center B-cell subtype constituted a unique group with extremely inferior outcome regardless of ethnicity PMID: 29801406
Overexpression of LIN28B promotes colon cancer development by increasing BCL-2 expression. PMID: 29669301
High BCL2 expression is associated with Prostate Cancer. PMID: 29641255
The findings of the present study indicated that icariin prevented injury and apoptosis in HUVECs following oxLDL treatment, in particular via the regulation of protein and mRNA expression levels of Bcl-2 and caspase-3. PMID: 29532884
BCL2 expression is also a strong predictive marker for DLBCL patients treated with R-CHOP. PMID: 28154089
High BCL2 expression is associated with drug resistance in ovarian cancer. PMID: 29286126
Elevated expression of Bcl-2 was an independent prognostic factor for poorer overall survival in triple-negative breast cancer and as such a significant marker for tumor aggressiveness. PMID: 28777433
CD30+ diffuse large B-cell lymphoma has characteristic clinicopathological features mutually exclusive with MYC gene rearrangement and negatively associated with BCL2 protein expression. PMID: 29666157
Phosphorylated and activated deoxycytidine kinase inhibits ionizing radiation (IR)-induced total cell death and apoptosis, and promotes IR-induced autophagy through the mTOR pathway and by inhibiting the binding of Bcl2 protein to BECN1 in breast cancer cells. PMID: 29393406
It was demonstrated that hypoxia stimulates migration and invasion in the MG63 human osteosarcoma cell line, which was correlated with the downregulation of miR15a and upregulation of B-cell lymphoma 2 (Bcl2) expression PMID: 29484432
miR-21 may promote salivary adenoid cystic carcinoma progression via PDCD4 and PTEN down-regulation and Bcl-2 up-regulation. PMID: 29328455
Paper analyses results of serum cytokines and lymphocyte apoptosis study in nodular goiter against the background of autoimmune thyroiditis and thyroid adenoma based on the cell preparedness to apoptosis, the number of apoptotic lymphocytes and the content of proapoptotic tumor necrosis factor-alpha, interleukins in serum, considering the polymorphism of BCL-2, CTLA-4 and APO-1 genes. PMID: 29250672
Permeabilisation of the mitochondrial outer membrane (MOMP) is directly regulated by the BCL-2 (B cell lymphoma 2) family in mammals [Review]. PMID: 28396106
The present study demonstrated that TATfused inositol 1,4,5trisphosphate receptorderived peptide (TATIDPS), which targets the BH4 domain of Bcl2, increased cisplatininduced Ca2+ flux from the endoplasmic reticulum (ER) into the cytosol and mitochondria. PMID: 29207009
we highlight the emerging recognition of MYC and BCL2 coexpression as the most robust predictor of diffuse large B cell lymphoma outcome, and discuss rationally conceived experimental approaches to treat these high-risk patients. PMID: 29198442
Bcl-2 binding to ARTS involves the BH3 domain of Bcl-2. Lysine 17 in Bcl-2 serves as the main acceptor for ubiquitylation, and a Bcl-2 K17A mutant has increased stability and is more potent in protection against apoptosis. PMID: 29020630
The expression levels of miR-204-5p were downregulated in prostate cancer cells compared with normal prostate epithelial cells. BCL2 mRNA and protein expression decreased in miR-204-5p-transfected cells, which led to cytochrome C release from mitochondria. Cotransfection of a reporter vector harboring the BCL2 3'-untranslated region to compete with endogenous transcripts partially rescued miR-204-5p-induced apoptosis. PMID: 27519795
GATA4 was a transcription factor that activated mouse double minute 2 homolog (MDM2) and B cell lymphoma 2 (BCL2) expression in ALL cells. PMID: 28849107
High BCL2 expression is associated with oncogenicity and chemoresistance in hepatocellular carcinoma. PMID: 28445151
Gastrin and BCL2 apoptosis regulator (Bcl2) are highly expressed in gastric cancer tissues, and they are correlated with the clinicopathologic features. PMID: 29268861
This study utilized a lentiviral vector that overexpressed the human VEGF and Bcl-2 genes simultaneously. Co-overexpression of VEGF and Bcl-2 inhibits the oxygen glucose deprivation induced apoptosis of mesenchymal stem cells. PMID: 28627637
Double-hit lymphoma (DHL) is an aggressive form of DLBCL with an unmet treatment need, in which MYC rearrangement is present with either BCL2 or BCL6 rearrangement PMID: 28952038
The expression of Bcl-2 and E cadherin immunopositivity was associated positively with tumor grade, high T category and histopathological grades. The results of this study points to the significance of cell proliferation and invasion as a major determinant of prognosis in OSCC. PMID: 28393810
meta-analysis suggests a role BCL-2 promoter polymorphisms in cancer susceptibility and prognosis; rs2279115 was associated with higher risk of cancer susceptibility in Asia but not in Caucasian; rs2279115 was associated with a higher risk in digestive system cancer and endocrine system cancer but not breast cancer, respiratory cancer and hematopoietic cancer PMID: 28445963
In this study, we investigated whether APG-1252-12A inhibits the growth of five leukemia cell lines in a concentration- or time-dependent manner by MTS assay.APG-1252-12A is a Bcl-2 homology (BH)-3 mimetic that specifically binds to Bcl-2 and Bcl-xl, which has shown efficacy in some Bcl-2 dependent hematological cancers PMID: 28586007
Multiple lines of evidence suggest formation of a potential cruciform DNA structure at MBR peak III, which was also supported by in silico studies. The formation of a non-B DNA structure could be a basis for fragility at BCL2 breakpoint regions, eventually leading to chromosomal translocations. PMID: 29246583
The upregulation of miR-219-5p inhibited melanoma growth and metastasis and strengthened melanoma cells chemosensitivity by targeting Bcl-2. Therefore, the modulation of miR-219-5p expression may be a novel treatment strategy in melanoma. PMID: 28884131
The expression of the anti-apoptotic protein Bcl-2 was greater in luminal A breast cancer tissue samples compared to triple-negative breast cancer. PMID: 28801774
Lnc_ASNR interacted with the protein ARE/poly (U)-binding/degradation factor 1(AUF1), which is reported to promote rapid degradation of the Bcl-2 mRNA, an inhibitor of apoptosis. Lnc_ASNR binds to AUFI in nucleus, decreasing the cytoplasmic proportion of AUF1 which targets the B-cell lymphoma-2 (Bcl-2) mRNA. PMID: 27578251
Bcl-2 high expression was significantly correlated with favorable overall survival and better disease/recurrence free survival in colorectal cancer.[meta-analysis] PMID: 28785155
High expression of bcl-2 in KCOT supports the general agreement that some features of KCOT are those of a neoplasia. The bcl-2 expression in connective tissue cells suggests that these cells may also be important as epithelial cells in the biological behavior odontogenic keratocyst PMID: 28862228
Results identified BCL2 as a direct target of miR-139-5p in colorectal cancer cells and showed that the tumor suppressor activity of miR-139-5p is mediated by the modulation of BCL2 expression. PMID: 27244080
Polo-like kinase inhibition can sensitize cholangiocarcinoma cells to cisplatin-induced apoptosis with proteasomal Bcl-2 degradation as an additional pro-apoptotic effect. PMID: 28652654
Lipid oxidation product 4-hydroxy-2-nonenal is at the crossroads of NF-kappaB pathway and anti-apoptotic Bcl2 expression. (Review) PMID: 27840321
Ibrutinib-resistant TMD8 cells had higher BCL2 gene expression and increased sensitivity to ABT-199, a BCL-2 inhibitor. Consistently, clinical samples from ABC-DLBCL patients who experienced poorer response to ibrutinib had higher BCL2 gene expression. We further demonstrated synergistic growth suppression by ibrutinib and ABT-199 in multiple ABC-DLBCL, GCB-DLBCL, and follicular lymphoma cell lines. PMID: 28428442
MUC1-C Stabilizes MCL-1 in the Oxidative Stress Response of Triple-Negative Breast Cancer Cells to BCL-2 Inhibitors PMID: 27217294
The BCL2 c.-938C>A and c.21G>A single-nucleotide polymorphisms showed a significant impact on outcome with transitional cell carcinoma of the bladder PMID: 28417194

Hide All

Involvement in disease

A chromosomal aberration involving BCL2 has been found in chronic lymphatic leukemia. Translocation t(14;18)(q32;q21) with immunoglobulin gene regions. BCL2 mutations found in non-Hodgkin lymphomas carrying the chromosomal translocation could be attributed to the Ig somatic hypermutation mechanism resulting in nucleotide transitions.

Subcellular Location

Mitochondrion outer membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.

Protein Families

Bcl-2 family

Tissue Specificity

Expressed in a variety of tissues.

Database Links

HGNC: 990

OMIM: 151430

KEGG: hsa:596

STRING: 9606.ENSP00000329623

UniGene: Hs.150749

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP002611HU1
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Apoptosis regulator Bcl-2 (BCL2), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage