Recombinant Human Fibroblast growth factor 2 (FGF2)

In Stock
Code CSB-YP008625HU
Abbreviation Recombinant Human FGF2 protein
MSDS
Size $306
Order now
Image
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP008625HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) FGF2.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP008625HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) FGF2.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Basic fibroblast growth factor; Basic fibroblast growth factor bFGF; BFGF; FGF 2; FGF B; FGF-2; Fgf2; FGF2 basic; FGF2_HUMAN; FGFB; Fibroblast growth factor 2 (basic); Fibroblast growth factor 2; Fibroblast growth factor; basic; HBGF 2; HBGF-2; HBGF2; HBGH 2; HBGH2; Heparin binding growth factor 2 precursor; Heparin-binding growth factor 2; Prostatropin
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
143-288aa
Target Protein Sequence
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human FGF2 is a yeast-expressed (143-288aa) protein with N-terminal 6xHis tag. The purity is 90%+ measured by SDS-PAGE. The highly developed genetic system, ease of use, reduced time input, and costs have made Pichia Pastoris an attractive organism for the expression and production of recombinant proteins. So we choose the Yeast system to express this recombinant FGF2 protein, which is able to carry specifically designed plasmids, and the plasmid used consists of restriction sites that can be used to insert the gene sequence of interest. Transformation of yeasts with the plasmid produces the desired protein and can be appropriately scaled up.

FGF2, a potent mitogen for fibroblasts, exerts multiple functions in tissue development and repair via interactions with FGFR1-3. The involvement of FGF2 in cell proliferation, differentiation, migration, and apoptosis in airway structural cells contributes to epithelial repair, ASMCs hyperplasia, and vascular remodeling. Since FGF2 plays important role in angiogenesis, extracellular matrix regulation, cell differentiation, and inflammatory responses, it is thus related to the development, progression, and pathogenesis of tumors. Studies have shown that FGF2 mediates cell migration and invasion in breast cancer, pancreatic cancer, astrocytes, and gliomas.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation.
Gene References into Functions
  1. The Novel Short Isoform of Securin Stimulates the Expression of Cyclin D3 and Angiogenesis Factors VEGFA and FGF2, but Does Not Affect the Expression of MYC Transcription Factor PMID: 29989583
  2. miR-155 and FGF2 is associated with esophageal cancer progression. miR-155 in Tumor-associated macrophages suppressed ECA109cell proliferation, migration and invasion, as well as reduction in angiogenesis. miR-155-reduced cell growth, migration and invasion of ECA109cells is associated with FGF2 suppression. PMID: 29660336
  3. the dual warhead-FGF2 conjugate may overcome the potential acquired resistance of FGFR1-overproducing cancer cells towards single cytotoxic drugs. PMID: 30029518
  4. widely stained in sclerosing stromal tumours of the ovary PMID: 29433373
  5. FGF2 initiates CYGB transcription via the JNK pathway. PMID: 28916723
  6. A strong stromal FGF-2 expression was associated with a significantly higher clinical stage and higher biochemical recurrence rate. Patients with strong stromal FGF-2 expression also had a significantly worse biochemical recurrence-free survival. PMID: 29887238
  7. levels of the angiogenesis mediators endoglin, HB-EGF, BMP-9 and FGF-2 in patients with severe sepsis and septic shock PMID: 28746898
  8. Our results suggest photodynamic therapy is effective in increasing the expression of bFGF gene, an important factor in periodontal tissue regeneration and could indicate periodontal tissue regeneration PMID: 28935533
  9. High FGF2 expression is associated with gastric cancer. PMID: 28500362
  10. Regulation of vascular smooth muscle cell calcification by syndecan-4/FGF-2/PKCalpha signalling and cross-talk with TGF-beta1. PMID: 29016732
  11. evaluation of the presence and localization of FGF2 in human sperm cells, and determination of FGF2 levels in semen samples and its relationship with conventional semen parameters PMID: 28732140
  12. We have presented evidence that FGF2 promotes myofibroblast apoptosis in vivo, antagonizes pro-fibrotic TGF-beta signaling, inhibits fibroblast activation and prevents transdifferentiation of non-fibroblasts into myofibroblasts, and promotes a less fibrotic gene expression paradigm [Review] PMID: 28967471
  13. These results demonstrate that FGF-TGFbeta signaling antagonism is the primary regulator of the smooth muscle cell phenotype switch. PMID: 27634335
  14. Results describe a novel role of FGF2 as a modulator of osteoblast and mesenchymal stromal cell function, and provide evidence for involvement of FGF2 in leukemia pathogenesis and chemo-resistance. PMID: 27481339
  15. Under specific experimental conditions, secretion of IL-1beta and FGF2 is triggered by phosphatidylinositol 4,5-bisphosphate [PI(4,5)P2]-dependent formation of pores across the plasma membrane. PMID: 28871048
  16. HDAC1 depletion activates cardiac mesenchymal stromal cells proangiogenic paracrine signaling in a basic fibroblast growth factor-dependent manner. PMID: 28679560
  17. The results suggest that FGF2/rs1048201, FGF5/rs3733336 and FGF9/rs546782 are associated with the risk of non-syndromic orofacial cleft and that these miRNA-FGF interactions may affect non-syndromic orofacial cleft development. PMID: 27511275
  18. TEC is yet another regulator of FGF2-mediated Human pluripotent stem cells pluripotency and differentiation. PMID: 28631381
  19. bFGF in primary tumor tissue associated with favorable breast cancer outcome and its levels significantly and positively correlated with ER levels. PMID: 28869446
  20. Serum FGF-2 levels were statistically significantly lower in the autism spectrum patient group compared to healthy controls. PMID: 28734240
  21. Dysregulation of the FGF2 gene represents an opportunity to understand further, and possibly intervene upon, mechanisms of wound healing in diabetics with CKD. PMID: 27237708
  22. Out of five FGF-2 Gene Polymorphism loci, the TA genotype of rs308442 in the osteoporosis group (40.2%) was higher than in the control group (29.5%) (p < 0.05). The rs308442 locus of FGF-2 gene is closely correlated to osteoporosis in this Zhuang ethnic Chinese cohort, and the TA may be the risk genotype of osteoporosis. PMID: 28653999
  23. Up-regulation of FGF2 and down-regulation FAM201A were correlated with the development of osteonecrosis of the femoral head after femoral neck fracture. PMID: 29382571
  24. over-expression, isolation, and biological activity of all recombinant human FGF2 isoforms, are reported. PMID: 28433654
  25. We found that hsa-miR-196a-3p affected expression on both mRNA and protein levels of FGF2. our study provided evidence that a functional SNP rs1048201 was associated with bone mineral density (BMD), and SNP rs1048201 variant may act by affecting binding of hsa-miR-196a-3p PMID: 28317323
  26. Data show that mutant soluble ectodomain of FGFR2IIIc (msFGFR2c) but not wild-type soluble ectodomain of FGFR2IIIc (wsFGFR2c) could selectively bind to c subtype of FGFRs in the presence of FGF-2. PMID: 28049184
  27. Furthermore, MERS coronavirus induced apoptosis through upregulation of Smad7 and fibroblast growth factor 2 (FGF2) expression in both kidney and lung cells. PMID: 27572168
  28. The present work aims to investigate the relationship between the expression of AEG-1(astrocyte elevated gene-1), b-FGF(basic-fibroblast growth factor), beta-catenin, Ki-67, TNF-alpha (tumor necrosis factor-alfa) other prognostic parameters in DC (Ductal Carcinomas) and ductal intraepithelial neoplasm. We found a relationship between these factors. PMID: 26096243
  29. Studies indicate that therapeutically targeting FGF2 and FGFR has been extensively assessed in multiple preclinical studies and numerous drugs and treatment options have been tested in clinical trials. PMID: 27007053
  30. FGF2 is involved in melanoma development and progression. HMW FGF2 isoforms enhance in vitro motility of melanoma cells. LMW FGF2 confers stem-like features and increases in vivo metastasization. LMW FGF2 promotes angiogenesis while HMW FGF2 induces vasculogenic mimicry. PMID: 27558498
  31. miR-105/Runx2 axis mediates FGF2-induced ADAMTS expression in osteoarthritis cartilage. PMID: 26816250
  32. results suggest that MALAT1-mediated FGF2 protein secretion from Tumor-associated macrophages inhibits inflammatory cytokines release, promotes proliferation, migration, and invasion of FTC133 cells and induces vasculature formation. PMID: 28543663
  33. This study reveals that Adv ECM hydrogels recapitulate matrix fiber microarchitecture of native adventitia, and retain angiogenesis-related actors and bioactive properties such as FGF2 signaling capable of influencing processes important for angiogenesis. PMID: 28167392
  34. Data show that FGF2 mutants have potential as anti-angiogenic agents and useful tools for studying the role of integrin alphavbeta3 in FGF2 signalling. PMID: 28302677
  35. Expression of these mediators was confirmed in end-stage COPD. Thus, accumulation of mast cells in COPD may contribute to vascular remodeling. PMID: 28298222
  36. Results provide evidence that bFGF regulates stemness maintenance in stem cells isolated from human exfoliated deciduous teeth (SHEDs) by enhancing REX-1 mRNA expression via the FGFR and Akt signaling pathways. Moreover, IL-6 is also involved in the bFGF-induced REX1 expression. PMID: 27883224
  37. Facial nerve regeneration using basic fibroblast growth factor-impregnated gelatin microspheres PMID: 24737684
  38. These results indicated that FGF-2, but not FGF-10, may be supplemented during stem cell expansion to prime cells for successful chondrogenesis and osteogenesis. PMID: 27411850
  39. the data suggest that endothelial cells regulate beta-catenin activity in adrenocortical cells also via secretion of basic fibroblast growth factor. PMID: 27889473
  40. In an in vitro assay of vascular smooth muscle cells, circRNA WDR77 silencing significantly inhibited cell proliferation and migration. Bioinformatics methods revealed that miR-124 and fibroblast growth factor 2 (FGF-2) were downstream targets of circRNA WDR77. PMID: 29042195
  41. FGF2 protects the tumor cells from the antiproliferative effect of Gefitinib and largely prevents reprogramming of the proteome and phosphoproteome PMID: 27794612
  42. High FGF2 expression is associated with colon cancer metastasis. PMID: 28629469
  43. These observations identify airway smooth muscle cells -derived FGF2b as a factor needed for LMC formation by CD4 T cells, affecting intercellular communication. PMID: 28924004
  44. Report no relationship between serum bFGF levels and ovarian cancer microvessel density and tumor bFGF expression. PMID: 27312585
  45. High FGF2 expression is associated with ovarian cancer. PMID: 28481872
  46. The antitumor activity of scopoletin may be due to its strong anti-angiogenic effect, which may be mediated by its effective inhibition of ERK1, VEGF-A, and FGF-2. PMID: 27133199
  47. TGF-beta, bFGF and epimorphin in the extracellular microenvironment cooperatively affect HSF behaviors under the control of a highly sulfated chondroitin sulfate PMID: 28209294
  48. High FGF2 expression is associated with lung cancer. PMID: 28423625
  49. miR-205 enhances chemosensitivity of breast cancer cells to TAC docetaxol, doxorubicin plus cyclophosphamide) by suppressing both VEGFA and FGF2, leading to evasion of apoptosis. PMID: 27362808
  50. analyses identified a new bFGF-regulating mechanism by which hedgehog signaling regulates human fibroblast migration; this data opens a new avenue for the wound healing therapy PMID: 28363830

Show More

Hide All

Subcellular Location
Secreted. Nucleus.
Protein Families
Heparin-binding growth factors family
Tissue Specificity
Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue.
Database Links

HGNC: 3676

OMIM: 134920

KEGG: hsa:2247

STRING: 9606.ENSP00000264498

UniGene: Hs.284244

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*