Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
alpha polypeptide (p32); CD8; CD8 antigen alpha polypeptide; CD8 antigen alpha polypeptide (p32); CD8a; CD8A antigen; CD8A molecule; CD8A_HUMAN; Leu2; Leu2 T lymphocyte antigen; Ly3; LYT3; MAL; OKT8 T cell antigen; OTTHUMP00000160760; OTTHUMP00000160764; OTTHUMP00000203528; OTTHUMP00000203721; p32; T cell antigen Leu2; T cell co receptor; T-cell surface glycoprotein CD8 alpha chain; T-lymphocyte differentiation antigen T8/Leu-2; T8 T cell antigen; T8/Leu-2 T-lymphocyte differentiation antigen
Species
Homo sapiens (Human)
Expression Region
22-182aa
Target Protein Sequence
SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The production of this Recombinant Human CD8A protein required the insertion of a DNA fragment (CD8A, 22-182aa) into a plasmid vector and the transferral of this vector into Mammalian cell cells (the step of transformation). The cells were then cultured and induced to express the CD8A protein. This recombinant protein was fused with N-terminal 6xHis tag. Its purity is 90%+ determined by SDS-PAGE.
CD8A(also called MAL) is a gene encoding a protein named T-cell surface glycoprotein CD8 alpha chain (also known as T-lymphocyte differentiation antigen T8/Leu-2 or CD8a) in human. CD8a protein can form homodimers and heterodimers with CD8a and CD8β, respectively. Both homodimers and heterodimers are CD8 protein, which is a co-receptor for T cell receptor when it interacts with MHC class I–peptide complex. the CD8a is required for expression of both dimers on the cell surface. Emerging evidence has revealed that CD8A gene is involved in coronavirus biology, and is relevant to COVID-19 prognosis.