Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A),partial

In Stock
Code CSB-YP004966HU
Size US$1298Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP004966HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD8A.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP004966HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD8A.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names CD8A
Uniprot No. P01732
Research Area Immunology
Alternative Names alpha polypeptide (p32); CD8; CD8 antigen alpha polypeptide; CD8 antigen alpha polypeptide (p32); CD8a; CD8A antigen; CD8A molecule; CD8A_HUMAN; Leu2; Leu2 T lymphocyte antigen; Ly3; LYT3; MAL; OKT8 T cell antigen; OTTHUMP00000160760; OTTHUMP00000160764; OTTHUMP00000203528; OTTHUMP00000203721; p32; T cell antigen Leu2; T cell co receptor; T-cell surface glycoprotein CD8 alpha chain; T-lymphocyte differentiation antigen T8/Leu-2; T8 T cell antigen; T8/Leu-2 T-lymphocyte differentiation antigen
Species Homo sapiens (Human)
Source Yeast
Expression Region 22-182aa
Target Protein Sequence SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 19.6kDa
Protein Length Extracellular Domain
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule
Gene References into Functions
  1. Studied lymphocyte phenotype in resected lymph nodes of patients with lung cancer by analyzing levels of Foxp3 and CD8 by immunohistochemical staining. PMID: 28831395
  2. This study compares the differences of PD-L1 expression and CD8+ tumor-infiltrating lymphocyte density, two major response biomarkers of PD-1/PD-L1 blockade, between paired primary and brain metastatic lesions in advanced non-small cell lung cancer (NSCLC). For NSCLC brain metastases patients, CD8+ tumor-infiltrating lymphocyte density showed a spatial and temporal heterogeneity. PMID: 29526752
  3. Endometrioid endometrial carcinomas are capable of down-regulating CD8 expression by cytotoxic T lymphocytes. PMID: 27346574
  4. The PD-1/CD8 ratio may, therefore, be a useful prognostic marker for stage II/III CRC. What is important for predicting the prognosis may be the PD-1/CD8 ratio rather than the absolute number of PD-1(+) tumor-infiltrating lymphocytes . PMID: 28739701
  5. We also observed a significant association between forkhead box protein 3 ( p = 0.001) and the Neo-Bioscore, while only a marginal difference was observed with CD8+ expression ( p = 0.074). This study demonstrated that forkhead box protein 3 expression has value as the only independent marker that predicts a good response to neoadjuvant chemotherapy and that it is related with a good prognosis according to the Neo-Biosc PMID: 28621227
  6. missense mutation increases susceptibility to recurrent respiratory infections PMID: 26563160
  7. Human mesenchymal stromal cells enhance the immunomodulatory function of CD8(+)CD28(-) regulatory T cells. PMID: 25482073
  8. Dendritic cells accumulate in the bone marrow of multiple myeloma patients and protect tumor plasma cells from CD8+ T-cell killing. PMID: 26185130
  9. Patients with the presence of CD8- and CD45RO-positive T cells in bone marrow demonstrated better survival of gastric cancer patients than those with the absence of these cells in bone marrow. PMID: 25804232
  10. More sCD8 circulating molecules were found in patients transfused with post-storage leucodepleted RBCs whose supernatants had large amounts of sHLA-I. sCD8 is a possible modulator of sHLA-I-mediated transfusion-related immunomodulation. PMID: 23356971
  11. CD8-positivity proved to be an independent prognostic predictor of worse outcome in pediatric anaplastic lymphoma kinase-positive anaplastic large cell lymphoma. PMID: 23716548
  12. CREMalpha orchestrates epigenetic remodeling of the CD8A,B through the recruitment of DNA methyltransferase (DNMT) 3a and histone methyltransferase G9a. PMID: 24297179
  13. Modified CD8A gene function may contribute to the development of refractory chronic rhinosinusitis via reduction of circulating CD8 lymphocytes. PMID: 23640800
  14. transcription factor cAMP-responsive element modulator alpha (CREMalpha), which is expressed at increased levels in T cells from systemic lupus erythematosus patients, contributes to transcriptional silencing of CD8A and CD8B. PMID: 24047902
  15. The CD8(+)CCR7(+) T-cell frequency in HNSCC patients' blood tested at diagnosis can discriminate them from normal controls and predicts disease recurrence PMID: 23363813
  16. The expression of human leucocyte antigen (HLA)-DR in epithelial cells and cluster of differentiation (CD8)-positive lymphocytes as possible markers of chronic ocular graft versus host disease, was investigated. PMID: 23878500
  17. HIV-1 clade-B Nef peptides elicit increased frequency, breadth and function of CD8+ T-cells compared to consensus peptides PMID: 23185362
  18. analysis of the effector phenotype of CD8+ T cells at the junction epithelium during clinical quiescence of herpes simplex virus 2 infection PMID: 22811543
  19. study confirms that CD8 expression is a recurrent albeit rare phenomenon in patients with chronic lymphocytic leukemia and suggests that CD8 expression has an adverse prognostic impact PMID: 22143984
  20. Silencing Hsp25/Hsp27 gene expression augments proteasome activity and increases CD8+ T-cell-mediated tumor killing and memory responses PMID: 22185976
  21. LNX1 and LNX2 interact with CD8alpha and promote its ubiquitylation and endocytosis. PMID: 22045731
  22. Nef-mediated down-modulation of CD8alphabeta is a fundamental property of primate lentiviruses. PMID: 22013062
  23. Multiple sclerosis is characterized by a dysregulation of CD8+CD56-perforin+ T cells that may play a role in the development of disability. PMID: 22001684
  24. Lymphoid tissue (LT)-resident CD8alpha-positive dendritic cells (DCs) and non(LT)-derived CD103-positive DCs express transgenic XCR1 and are characterized by a unique transcriptional fingerprint, irrespective of their tissue of origin. PMID: 21948982
  25. Coreceptor CD8alphabeta contributes to the antigen-recognition process by binding to a largely invariant region of the MHC class I molecule and by promoting intracellular signaling. PMID: 21954283
  26. These results suggest that the elevated frequency of PD-1(+) CD8(+) T cells could be associated with leukemic relapse in pediatric umbilical cord blood transplantation recipients. PMID: 21813446
  27. The aim was to determine if SPARC, FOXP3, CD8 and CD45RO expression levels are associated with colorectal cancer (CRC) stage, disease outcome and long-term cancer-specific survival PMID: 21818290
  28. we present the complex structures of human CD8alphaalpha bound to HLA-A*2402 PMID: 21645925
  29. the presence of IL-1 and/or IL-6 during activation of human CD8 T cells attenuates Fas-mediated AICD, whereas IL-12 increases the susceptibility of activated CD8 T cells to this form of cell death PMID: 21518761
  30. In the setting of HIV-induced lymphopenia, naive CD4-expressing T cells are recruited mainly into the proliferating pool in response to CD4 T cell depletion, whereas naive CD8-positive T cell proliferation is driven mainly by levels of HIV RNA. PMID: 21257970
  31. Studies indicate that The thymus leukemia (TL) antigen and CD8alphaalpha are interacting surface molecules that are expressed at the frontline of the mucosal immune system. PMID: 20850477
  32. PD-L1 and PD-L2 knockdown dendritic cells showed superior potential to expand minor histocompatibility antigen-specific CD8(+) effector and memory T cells from leukemia patients early after donor lymphocyte infusion and later during relapse. PMID: 20682852
  33. The study shows that impaired Epstein-Barr virus-specific CD8+ T-cell function in X-linked lymphoproliferative disease is restricted to SLAM family-positive B-cell targets. PMID: 20644117
  34. The positive rate of CD8 in primary lung cancer tissue was significantly higher than that in normal lung tissue. PMID: 20704820
  35. Binding of the CD8 coreceptor to class I histocompatibility molecules significantly enhances the amount of calcium released from intracellular stores, triggered by a weaker ESO1 peptide agonist. PMID: 20053942
  36. Four new weak but tissue-specific DNase I hypersensitivity sites have been mapped 0-0.8 kb upstream of the first exon of CD8A, in the promoter region. PMID: 11937547
  37. Soluble HLA-A,-B,-C and -G molecules induce apoptosis in T and NK CD8+ cells and inhibit cytotoxic T cell activity through CD8 ligation. PMID: 12594841
  38. expression of the HMG box protein TOX is sufficient to induce changes in coreceptor gene expression associated with beta-selection, including CD8 gene demethylation PMID: 15078895
  39. Establishment of a permanent CD8+ cell line from a patient with leukemic phase of acute lymphoblastic lymphoma. PMID: 15927673
  40. p32 recruits ganciclovir kinase to redistribute the nuclear lamina. PMID: 15975922
  41. Introduction of CD8 alpha down-regulates the production of major T helper (Th) type 2 cytokines and may induce differentiation of tumor-specific Th1 cells to improve the clinical potential of T cell receptor (TCR) gene transfer to treat melanoma. PMID: 16818755
  42. The results indicate that p.Gly111Ser is confined to the Spanish Gypsy population, where it occurs at a carrier rate of 0.4%. PMID: 17658607
  43. human monocytes express CD8 alpha; co-engagement of CD8 alpha and FcR enhances monocyte TNF release, suggesting FcR may be a novel partner receptor for CD8 alpha on innate immune cells PMID: 17678538
  44. CD8+FOXP3+ T cells play an important role in unresponsiveness related to upregulated interleukin receptors on dendritic cells. PMID: 18089323
  45. Data suggest that Bim-mediated attrition of HBV-specific CD8(+) T cells contributes to the inability of these cell populations to persist and control viral replication. PMID: 18398508
  46. tumor-induced TGF-beta may actively subvert the CD8+ arm of the immune system into directly promoting tumor growth by an IL-17-dependent mechanism PMID: 18483277
  47. Data suggest that a decrease in CD8+CD28- T cells may reflect impaired T-cell suppression and accordingly, increased T cell help to autoreactive B cells in patients with systemic lupus erythematosus. PMID: 18625635
  48. analysis of an interaction between B7-H3 and TLT-2 that preferentially enhances CD8(+) T cell activation PMID: 18650384
  49. polarized CD8 T cells within the HBV-infected liver may impede proliferative antiviral effector function, while contributing to the proinflammatory cytokine environment PMID: 18695005
  50. in patients with melanoma, who underwent a peptide-based vaccination, homodimer may represent a marker of antigen-specific T-cell memory PMID: 18833003
  51. An important finding was the difference in the results on targeting the CD8 antigen by using two different commercially available monoclonal antibodies. PMID: 18956469
  52. self-class I MHC molecules support CD8 T cell survival, but that these interactions also attenuate naive T cell sensitivity by dynamic tuning of CD8 levels. PMID: 19752186
  53. Data show that CD8+LAP+ cells produce IFN-gamma, and these cells suppress EAE that is dependent on both TGF-beta and IFN-gamma. PMID: 19768696
  54. Results indicate that CD8(+) T cells actively contribute to macrophage accumulation and the development of irritant-induced airspace enlargement in a mouse model of COPD. PMID: 17950725

Show More

Hide All

Involvement in disease CD8 deficiency, familial (CD8 deficiency)
Subcellular Location Isoform 1: Cell membrane, Single-pass type I membrane protein
Tissue Specificity CD8 on thymus-derived T-cells usually consists of a disulfide-linked alpha/CD8A and a beta/CD8B chain. Less frequently, CD8 can be expressed as a CD8A homodimer. A subset of natural killer cells, memory T-cells, intraepithelial lymphocytes, monocytes and
Database Links

HGNC: 1706

OMIM: 186910

KEGG: hsa:925

STRING: 9606.ENSP00000283635

UniGene: Hs.85258

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1