Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A),partial

In Stock
Code CSB-YP004966HU
Product Type Recombinant Protein
Size US$2010Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P01732
Relevance Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP004966HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD8A.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP004966HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD8A.
Storage Buffer Tris-based buffer,50% glycerol
Alias T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen: CD8a
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Research Area Immunology
Source Yeast
Gene Names CD8A
Protein Names Recommended name: T-cell surface glycoprotein CD8 alpha chain Alternative name(s): T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen= CD8a
Expression Region 22-182aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 19.6kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule
Involvement in disease CD8 deficiency, familial (CD8 deficiency)
Subcellular Location Isoform 1: Cell membrane, Single-pass type I membrane protein
Tissue Specificity CD8 on thymus-derived T-cells usually consists of a disulfide-linked alpha/CD8A and a beta/CD8B chain. Less frequently, CD8 can be expressed as a CD8A homodimer. A subset of natural killer cells, memory T-cells, intraepithelial lymphocytes, monocytes and
Database Links

HGNC: 1706

OMIM: 186910

KEGG: hsa:925

STRING: 9606.ENSP00000283635

UniGene: Hs.85258

Pathway Antigen processing and presentation
Hematopoietic cell lineage
T cell receptor signaling pathway

Related Products

CD8A Antibodies

CD8A Antibodies for Homo sapiens (Human)

CD8A Proteins

CD8A Proteins for Homo sapiens (Human)

CD8A ELISA Kit

CD8A ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.