Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-YP004966HU |
| Product Type | Recombinant Protein |
| Size |
US$2010Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.) |
| Uniprot No. | P01732 |
| Relevance | Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen: CD8a |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD |
| Research Area | Immunology |
| Source | Yeast |
| Gene Names | CD8A |
| Protein Names | Recommended name: T-cell surface glycoprotein CD8 alpha chain Alternative name(s): T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen= CD8a |
| Expression Region | 22-182aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 19.6kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule |
| Involvement in disease | CD8 deficiency, familial (CD8 deficiency) |
| Subcellular Location | Isoform 1: Cell membrane, Single-pass type I membrane protein |
| Tissue Specificity | CD8 on thymus-derived T-cells usually consists of a disulfide-linked alpha/CD8A and a beta/CD8B chain. Less frequently, CD8 can be expressed as a CD8A homodimer. A subset of natural killer cells, memory T-cells, intraepithelial lymphocytes, monocytes and |
| Database Links |
HGNC: 1706 OMIM: 186910 KEGG: hsa:925 STRING: 9606.ENSP00000283635 UniGene: Hs.85258 |
| Pathway |
Antigen processing and presentation
Hematopoietic cell lineage T cell receptor signaling pathway |
CD8A Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA004966LA01HU | CD8A Antibody | Human | ELISA, IHC |
| CSB-PA004966LB01HU | CD8A Antibody, HRP conjugated | Human | ELISA |
| CSB-PA004966LC01HU | CD8A Antibody, FITC conjugated | Human | ELISA |
| CSB-PA004966LD01HU | CD8A Antibody, Biotin conjugated | Human | ELISA |
CD8A Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP004966HU | Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A),partial | E.coli |
| CSB-MP004966HU | Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A),partial | Mammalian cell |
| CSB-BP004966HU |
Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A),partial | Baculovirus |
CD8A ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E12707h | Human Cluster of differentiation 8,CD8 ELISA Kit | serum, plasma, cell culture supernates, tissue homogenates | 15.6 U/mL |
Recombinant Rabbit Apolipoprotein E(APOE),partial
Express system: E.coli
Species: Oryctolagus cuniculus (Rabbit)
Recombinant Sheep Protransforming growth factor alpha(TGFA),partial
Express system: E.coli
Species: Ovis aries (Sheep)
Recombinant Human Macrophage mannose receptor 1(MRC1),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Aldehyde dehydrogenase family 1 member A3(ALDH1A3)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Protein mago nashi homolog(MAGOH)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Alcohol dehydrogenase 1C(ADH1C)
Express system: E.coli
Species: Homo sapiens (Human)
