Code | CSB-YP004966HU |
Size |
US$2010Purchase it in Cusabio online store (only available for customers from the US) |
Image |
|
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | CD8A |
Uniprot No. | P01732 |
Research Area | Immunology |
Alternative Names | T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen: CD8a |
Species | Homo sapiens (Human) |
Source | Yeast |
Expression Region | 22-182aa |
Target Protein Sequence | SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 19.6kDa |
Protein Length | Extracellular Domain |
Tag Info | N-terminal 6xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule |
Involvement in disease | CD8 deficiency, familial (CD8 deficiency) |
Subcellular Location | Isoform 1: Cell membrane, Single-pass type I membrane protein |
Tissue Specificity | CD8 on thymus-derived T-cells usually consists of a disulfide-linked alpha/CD8A and a beta/CD8B chain. Less frequently, CD8 can be expressed as a CD8A homodimer. A subset of natural killer cells, memory T-cells, intraepithelial lymphocytes, monocytes and |
Database Links |
HGNC: 1706 OMIM: 186910 KEGG: hsa:925 STRING: 9606.ENSP00000283635 UniGene: Hs.85258 |
Recombinant Staphylococcus aureus Phospholipase C(hlb)
Express system: Yeast
Species: Staphylococcus aureus
Recombinant Human Endothelin-1 receptor(EDNRA)
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Recombinant Human Mast cell carboxypeptidase A(CPA3)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Melanocyte protein PMEL(PMEL),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Rat Allograft inflammatory factor 1(Aif1)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human E3 ubiquitin-protein ligase RBX1(RBX1)
Express system: E.coli
Species: Homo sapiens (Human)