Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

The ED50 as determined in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 3.5 pg/ml.

Target Names

TNF

Uniprot No.

P04924

Research Area

Cancer

Alternative Names

TNF; TNFA; TNFSF2; Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a

Species

Oryctolagus cuniculus (Rabbit)

Source

E.coli

Expression Region

78-235aa

Complete Sequence

VTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHRETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL

Mol. Weight

17.59 kDa

Protein Length

Partial

Tag Info

Tag-Free

Form

Liquid or Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20mM PB, 250mM NaCl, pH 7.4.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Datasheet & COA

Please contact us to get it.

Description

Rabbit TNF-α drives potent cytotoxicity with an ED50 of 3.5 pg/ml in the L-929/actinomycin D assay, confirming exceptional signaling activity that supports use in NF-κB and MAPK pathway activation studies, apoptosis assays, and species-matched in vivo tumor biology models. This tag-free recombinant protein encompasses the mature extracellular domain (aa 78–235), preserving native receptor-binding topology critical for accurate functional readouts. Endotoxin levels below 1.0 EU/μg eliminate LPS-driven artifacts in immune cell assays, making this preparation appropriate for TNF-α-dependent macrophage activation experiments, antibody development as an immunogen or ELISA standard, and cytotoxicity dose-response characterization. Purity exceeding 95% by SDS-PAGE, combined with the low endotoxin burden, satisfies the quality thresholds commonly required for sensitive cell-based functional studies where unambiguous attribution of biological effects to TNF-α is essential.

Target Background

Function

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6.; The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.

Gene References into Functions

TUNEL staining was positively correlated with TNF-a protein expression. Our findings suggest that apoptosis can be induced in the vocal fold epithelium after 120min of modal intensity phonation. In contrast, shorter durations of vibration exposure do not result in apoptosis signaling. PMID: 27577014
Inflammatory factors such as TNF-alpha can stimulate MMP-2/9 activity in corneal epithelium cells. This may be a potential manipulating mechanism of MMP expression in the pathogenesis of corneal diseases. PMID: 26125840
The JNK pathway plays an important role in mechanical ventilation-stimulated TNF-alpha expression in alveolar macrophages, but the injury-stimulated IL-8 expression may be regulated by other signaling pathways. PMID: 24070709
The TNFalpha-evoked Cl- current. PMID: 24084720
IL-1beta and TNF-alpha expression increases significantly during acute lung injury. Ambroxol combined with low-dose heparin inhibits teh release of IL-1beta and TNF-alpha. PMID: 21845882
Hypercapnia increased expression of TNFa and decreased expression of NFKB in acute lung injury models. PMID: 21158126
In the early stages of myocardial ischemia, bone marrow stem cells are mobilized and home to ischemic myocardium with a concomitant increase in expression of cytokines VEGF and TNFalpha. PMID: 20624659
Ammonium perchlorate can increase gene expressions of types I, III collagens, TGF-beta(1) and TNF-alpha in lung of rabbits. PMID: 20937628
TNFalpha may either be directly or indirectly involved in vascular damage following an embolic stroke. Moreover, TNFalpha may mediate some of the detrimental effects of tPA on the vascular compartment PMID: 17673188

Hide All

Subcellular Location

Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, membrane form]: Membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, soluble form]: Secreted.; [C-domain 1]: Secreted.; [C-domain 2]: Secreted.

Protein Families

Tumor necrosis factor family

Database Links

KEGG: ocu:100009088

STRING: 9986.ENSOCUP00000005787

UniGene: Ocu.1971

Code	CSB-AP005051RB
Abbreviation	Recombinant Rabbit TNF protein, partial (Active)
MSDS	MSDS Datasheet
Size	$226
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rabbit Tumor necrosis factor (TNF), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage