Recombinant Rabbit Tumor necrosis factor(TNF),partial

In Stock
Code CSB-AP005051RB
Product Type Tumor Necrosis Factor
Size US$153
Uniprot No. P04924
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 300 mM NaCl, pH 7.4
Alias Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; TNF; TNFA; TNFSF2
Species Oryctolagus cuniculus (Rabbit)
Biological_Activity The ED50 as determined in a cytotoxicity assay using L?929 mouse fibroblast cells is less than 20 pg/ml in the presence of the metabolic inhibitor actinomycin D.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence MVTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHRETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL
Research Area Cancer
Source E.coli
Gene Names TNF
Expression Region 77-235aa
Tag Info Tag-Free
Mol. Weight 17.59 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.; FUNCTION
Subcellular Location Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, membrane form: Membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, soluble form: Secreted, SUBCELLULAR LOCATION: C-domain 1: Secreted, SUBCELLULAR LOCATION: C-domain 2: Secreted
Protein Families Tumor necrosis factor family
Database Links

KEGG: ocu:100009088

STRING: 9986.ENSOCUP00000005787

UniGene: Ocu.1971

Pathway MAPK signaling pathway
mTOR signaling pathway
TGF-beta signaling pathway
NF-kappa B signaling pathway
TNF signaling pathway
Apoptosis
Necroptosis
Antigen processing and presentation
Fc epsilon RI signaling pathway
Hematopoietic cell lineage
IL-17 signaling pathway
Natural killer cell mediated cytotoxicity
NOD-like receptor signaling pathway
Osteoclast differentiation
T cell receptor signaling pathway
Toll-like receptor signaling pathway
Adipocytokine signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Inflammatory Pain

Related Products

TNF Antibodies

TNF Antibodies for Oryctolagus cuniculus (Rabbit)

TNF Proteins

TNF Proteins for Oryctolagus cuniculus (Rabbit)

TNF ELISA Kit

TNF ELISA Kit for Oryctolagus cuniculus (Rabbit)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.