Recombinant Human Interleukin-1 alpha(IL1A),partial (Active) (GMP)

In StockGMP
Code CSB-AP005801HU
Product Type Interleukin
Size $6883
Uniprot No. P01583
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered concentrated solution in 25 mM Tris-HCl, pH8.0.
Alias Hematopoietin-1,IL-1 alpha
Species Homo sapiens (Human)
Biological_Activity Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 1.0 pg/ml, corresponding to a specific activity of > 1.0 × 109 IU/mg.
Purity > 98 % by SDS-PAGE and HPLC analyses
Endotoxin Less than 0.01 EU/μg of rHuIL-1α GMP as determined by LAL method.
Sequence SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Research Area Immunology
Source E.Coli
Gene Names IL1A
Expression Region 133-271aa
Tag Info Tag-Free
Mol. Weight 18 kDa
Protein Description Partial
PubMed ID 2989698; 3486405; 2994016; 2635664; 3485152; 3493774; 11991722; 14702039; 15815621; 15489334; 3281727; 8346241; 2346741
Still Have Questions? Leave a Message or Start an on-line Chat
Function Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Subcellular Location Secreted
Protein Families IL-1 family
Database Links

HGNC: 5991

OMIM: 147760

KEGG: hsa:3552

STRING: 9606.ENSP00000263339

UniGene: Hs.1722

Pathway MAPK signaling pathway
Cellular senescence
Necroptosis
Hematopoietic cell lineage
Osteoclast differentiation
AGE-RAGE signaling pathway in diabetic complications

Related Products

IL1A Antibodies

IL1A Antibodies for Homo sapiens (Human)

IL1A Proteins

IL1A Proteins for Homo sapiens (Human)

IL1A ELISA Kit

IL1A ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.