Recombinant Human Interleukin-13 (IL13) (Active)

In Stock Promotion
Code CSB-MP6408HU
Abbreviation Recombinant Human IL13 protein (Active)
MSDS
Size $138
Order now
Promotion
20% OFF Promotion on CUSABIO Premium Active Proteins
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 2.045-6.215 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 2.045-6.215 ng/mL.
Target Names
Uniprot No.
Alternative Names
/
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
21-132aa
Target Protein Sequence
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Mol. Weight
13.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human IL13 protein is produced by the HEK293 cell expression system. It is expressed with sequence (Gly21-Asn132) of human IL13 fused with a 10xHis tag at the C-terminus. The purity of this recombinant IL13 protein is over 95% as determined by SDS-PAGE. Its endotoxin is less than 1.0 EU/ug as measured by the LAL method. It has been validated to be biologically active in a proliferation assay. The ED50 as accessed by the dose-dependent stimulation of the proliferation of TF-1 cells is 2.045-6.215 ng/mL.

IL13 is a cytokine that plays a pivotal role in the immune system, particularly in mediating type 2 immune responses. It is primarily produced by Th2 cells, mast cells, and eosinophils, and is known for its involvement in various physiological and pathological processes, including allergic reactions, asthma, and other inflammatory diseases [1][2]. IL13 shares structural similarities with IL4 and exhibits overlapping functions, particularly in promoting IgE class switching in B cells, which is crucial for allergic responses [1][2].

The IL13 protein exerts its effects by binding to specific receptors, IL13Rα1 and IL13Rα2. The interaction with these receptors activates downstream signaling pathways, notably the JAK1/STAT6 pathway, which mediates many of its biological effects, including the regulation of gene expression related to inflammation and immune responses [3][4]. Notably, IL13Rα2 acts as a decoy receptor, which can inhibit the signaling of IL13, thereby modulating its effects in various contexts, such as in inflammatory bowel disease [3].

Research has also highlighted the dual role of IL13 in inflammation. While it is known to promote anti-inflammatory responses, its dysregulation can lead to pathological conditions. Elevated levels of IL13 have been associated with autoimmune diseases and chronic inflammatory conditions, such as asthma and chronic obstructive pulmonary disease (COPD) [5]. Genetic polymorphisms in the IL13 gene have been linked to variations in susceptibility to these diseases, indicating that genetic factors may influence IL13 expression and function [5].

Furthermore, IL13 has been implicated in tissue remodeling and fibrosis, particularly in the lungs and gastrointestinal tract. It promotes the differentiation of macrophages towards an M2 phenotype, which is associated with tissue repair and fibrosis, thus playing a significant role in chronic inflammatory conditions [6][7]. In the context of cancer, engineered variants of IL13 have been developed for targeted therapies, particularly in tumors that overexpress IL13 receptors, showcasing its potential in immunotherapy [8].

References:
[1] C. Hoornaert, E. Luyckx, K. Reekmans, M. Dhainaut, C. Guglielmetti, D. Blon, et al. In vivo interleukin-13-primed macrophages contribute to reduced alloantigen-specific t cell activation and prolong immunological survival of allogeneic mesenchymal stem cell implants, The International Journal of Cell Cloning, vol. 34, no. 7, p. 1971-1984, 2016. https://doi.org/10.1002/stem.2360
[2] K. TENBROCK, A. SCHUBERT, L. STAPENHORST, M. KEMPER, J. GELLERMANN, K. TIMMERMANN, et al. Type i ige receptor, interleukin 4 receptor and interleukin 13 polymorphisms in children with nephrotic syndrome, Clinical Science, vol. 102, no. 5, p. 507, 2002. https://doi.org/10.1042/cs20010229
[3] T. Yau, J. Vadakekolathu, G. Foulds, G. Du, C. Polytarchou, B. Dickins, et al. Hyperactive chemotaxis contributes to anti-tnfα treatment resistance in inflammatory bowel disease,, 2021. https://doi.org/10.1101/2021.08.15.456400
[4] N. Wood, M. Whitters, B. Jacobson, J. Witek, J. Sypek, M. Kasaian, et al. Enhanced interleukin (il)-13 responses in mice lacking il-13 receptor α 2, The Journal of Experimental Medicine, vol. 197, no. 6, p. 703-709, 2003. https://doi.org/10.1084/jem.20020906
[5] S. Liu, H. Chang, Y. Chang, H. Kuo, & Y. Tsai. Il13 promoter (−1055) polymorphism associated with leukocyte mitochondria dna copy number in chronic obstructive pulmonary disease, Cells, vol. 11, no. 23, p. 3787, 2022. https://doi.org/10.3390/cells11233787
[6] C. Petersen, A. Meyer, C. Salvo, E. Choi, C. Schlegel, A. Petersen, et al. A signalling cascade of il-33 to il-13 regulates metaplasia in the mouse stomach, Gut, vol. 67, no. 5, p. 805-817, 2017. https://doi.org/10.1136/gutjnl-2016-312779
[7] C. Noto, S. Hoft, K. Bockerstett, N. Jackson, E. Ford, L. Vest, et al. Il13 acts directly on gastric epithelial cells to promote metaplasia development during chronic gastritis, Cellular and Molecular Gastroenterology and Hepatology, vol. 13, no. 2, p. 623-642, 2022. https://doi.org/10.1016/j.jcmgh.2021.09.012
[8] L. Stern, S. Gholamin, I. Moraga, X. Yang, S. Saravanakumar, J. Cohen, et al. Engineered il13 variants direct specificity of il13rα2-targeted car t cell therapy, Proceedings of the National Academy of Sciences, vol. 119, no. 33, 2022. https://doi.org/10.1073/pnas.2112006119

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*