Recombinant Human Receptor tyrosine-protein kinase erbB-3 (ERBB3), partial (Active)

In Stock
Code CSB-MP007765HU
Abbreviation Recombinant Human ERBB3 protein, partial (Active)
MSDS
Size $116
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized NRG1(CSB-MP016077HU1(F6)) at 2 μg/ml can bind human ERBB3, the EC50 is 12.32-15.74 ng/ml. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized NRG1(CSB-MP016077HU1(F6)) at 2 μg/ml can bind human ERBB3, the EC50 is 12.32-15.74 ng/ml.
Target Names
Uniprot No.
Alternative Names
(Proto-oncogene-like protein c-ErbB-3)(Tyrosine kinase-type cell surface receptor HER3)(HER3)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
20-643aa
Target Protein Sequence
SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLT
Mol. Weight
96.4 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

ERBB3 (HER3) plays a critical role in heterodimeric signaling with other ErbB family members, and its extracellular domain is a key target for therapeutic antibody development and ligand-interaction studies. This recombinant human ERBB3 construct spans the extracellular region (aa 20–643) with a C-terminal hFc1 tag, and its production in mammalian cells supports native-like glycosylation and conformational integrity essential for accurate ligand-binding results. Functional ELISA confirms that immobilized NRG1 binds this protein with an EC50 of 12.32–15.74 ng/ml, providing a validated basis for receptor-ligand interaction assays, competitive inhibition studies, blocking antibody screening, and therapeutic antibody epitope mapping by SPR or BLI. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the quality criteria typical for cell-based drug discovery assays and small-molecule or biologic inhibitor screening campaigns.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Binding assay/Protein-protein interaction

Review: I used CSB-MP007765HU product for a functional ELISA experiment, EC50 was 18.24-23.66 ng/ml, and the protein had complete biological activity. Subsequently, this product was used for affinity experiments, and its affinity activity was very good, and it has been successfully applied for clinical application. CUSABIO products have short delivery times, the price is favorable, and I will purchase large quantities in the future!

By Anonymous

Target Background

Function
Tyrosine-protein kinase that plays an essential role as cell surface receptor for neuregulins. Binds to neuregulin-1 (NRG1) and is activated by it; ligand-binding increases phosphorylation on tyrosine residues and promotes its association with the p85 subunit of phosphatidylinositol 3-kinase. May also be activated by CSPG5. Involved in the regulation of myeloid cell differentiation.
Gene References into Functions
  1. ERBB3 mutations can be found in a wide variety of tumour types, and can be used to select treatment with HER family inhibitors. PMID: 29413684
  2. identified P2RX2, KCNQ5, ERBB3 and SOCS3 to be associated with the progression of age-related hearing impairment PMID: 29325454
  3. Results demonstrate that 4-PBA promotes gastric cancer cells migration through upregulation of HER3/HER4 subsequent to increased levels of acetyl-histone and activation of ERK signaling. PMID: 28851073
  4. miR152 was found to be involved in the proliferation and metastasis of ovarian cancer cells through repression of ERBB3 expression. PMID: 29286064
  5. This phase Ib study was designed to determine the MTD, safety, preliminary efficacy, and pharmacokinetics of the HER3 (ErbB3) mAb SAR256212 in combination with the oral PI3K inhibitor SAR245408 for patients with metastatic or locally advanced solid tumors. PMID: 28031425
  6. To determine additional resistance mechanisms to cetuximab treatment besides HER3 signaling. PMID: 28910149
  7. Study shows ErbB3 expression was markedly decreased in suicide completers compared to controls. PMID: 28675388
  8. EGFR expression is increased in oesophageal and gastric adenocarcinomas after neoadjuvant therapy and was significantly associated with a prolonged overall survival in univariable analysis. PMID: 29138285
  9. Using time-resolved-fluorescence energy transfer (TR-FRET), we demonstrated that in the presence of recombinant NRG1, binding of 9F7-F11 to HER3 is increased, whereas that of ligand-competing anti-HER3 antibodies (H4B-121, U3-1287, Ab#6, Mab205.10.2, and MOR09825) is decreased. PMID: 28507002
  10. This study uncovers a direct relationship between HPV infection and HER3 in head and neck squamous cell carcinomas and provides a rationale for the clinical evaluation of targeted HER3 therapy for the treatment of HPV(+) patients. PMID: 27986750
  11. Cetuximab treatment induced HER3 activation and HER2/HER3 dimerization in head and neck squamous cell carcinoma cell lines. Cetuximab induces HER3 expression and activation in HNSCC cell lines. Upregulation of HER3 by cetuximab is one mechanism underlying resistance to EGFR inhibition in HNSCC. PMID: 27358485
  12. High HER3 expression is associated with breast cancer. PMID: 27582551
  13. hematopoietic expression of ERBB3 appears to be highest in bone marrow common myeloid and megakaryocyte-erythrocyte progenitors. Identified ERBB3 as a candidate gene for predisposition to erythroid MDS/AML PMID: 27416908
  14. High LINC00052 levels predict activation of HER3-mediated signaling, promoting breast cancer growth. PMID: 28036286
  15. we show that ErbB3 interacts with the ESCRT-0 subunit Hrs both in the presence and absence of heregulin. This indicates an ESCRT-mediated sorting of ErbB3 to late endosomes and lysosomes, and in line with this we show that impaired ESCRT function leads to an endosomal accumulation of ErbB3. PMID: 28867611
  16. our findings provide support for an autocrine signaling loop engaged by oncogenic K-Ras involving ErbB3 that contributes to the dedifferentiation of the intestinal epithelium during tumor initiation and progression. PMID: 27447549
  17. Results indicate the feasibility by using a pharmacophore of the small molecular compound VS1 for designing and optimization of proto-oncogene protein erbB-3 (ERBB3) inhibitors. PMID: 27188722
  18. The A/A genotype of the ERBB3 rs2292239 SNP is associated with risk for T1DM in a white Brazilian population. PMID: 29109006
  19. Results shows that HER3 mRNA is upregulated in hepatocellular carcinoma associated to chronic HBV infection. PMID: 27514687
  20. Data show that afatinib resistant clones were selectively killed by knock down of ERBB3 + c-MET + c-KIT, but not by the individual or doublet knock down combinations, and the combination of afatinib with the SRC family inhibitor dasatinib killed afatinib resistant H1975 cells in a greater than additive fashion. PMID: 26934000
  21. results suggest that the combination of a histone deacetylase inhibitor (HDACi) plus an anti-ErbB3 MoAb represents a viable strategy that warrants further evaluation for the treatment of non-small cell lung cancer (NSCLC) patients. PMID: 26862736
  22. observations suggest that Rtn4A counteracts the Nrdp1-mediated degradation of ErbB3 by sequestering the ubiquitin ligase into ER tubules. PMID: 27353365
  23. Engineered multivalency enhanced affibody-mediated HER3 downregulation in multiple cancer cell types. PMID: 28248115
  24. Pretreatment with the soluble ErbB3 N418Q mutant suppressed heregulin beta1-induced HIF-1alpha activation in MCF7 cells. PMID: 25451255
  25. review and meta-analysis of essential role in clinicopathology and prognosis of gastric cancer PMID: 27536774
  26. HER3 is frequently overexpressed in high-grade dysplastic lesions of the gastroesophageal junction and may be a marker of invasive progression PMID: 27559738
  27. the mechanistic regulation and linkage of the ROR1-HER3 and Hippo-YAP pathway in a cancer-specific context PMID: 28114269
  28. Detecting nuclear ErbB380kDa could constitute a useful marker of prostate cancer progression. PMID: 27191720
  29. YAP induces the expression of epidermal growth factor (EGF) receptors (EGFR, ERBB3) and production of EGF-like ligands (HBEGF, NRG1 and NRG2); YAP induces the expression of epidermal growth factor (EGF) receptors (EGFR, ERBB3) and production of EGF-like ligands (HBEGF, NRG1 and NRG2) PMID: 25798835
  30. In high-grade serous ovarian carcinoma (HGSC), high HER3 mRNA expression was a favorable prognostic factor for survival, while for high HER3 protein expression, a trend towards better survival was seen. A subgroup of HGSC with negative HER3 staining and negative HER3 mRNA levels showed most unfavorable survival. PMID: 27913862
  31. ERBB3 and ERBB4 have roles in lung adenocarcinoma PMID: 26254096
  32. Results suggest that silibinin is a potential anti-cancer drug to inhibit proliferative and invasive characteristics of the epithelial ovarian cancer (EOC) cells that exhibit an autocrine heregulin (HRG)/HER3 protein (HRG/HER3) pathway. PMID: 26482609
  33. findings suggest that HBx promotes the progression of hepatocellular carcinoma by decreasing the stability of Nrdp1, which results in up-regulation of ErbB3 PMID: 26846102
  34. High HER3 expression in colon cancer was associated to distal colon location and low-grade tumor. PMID: 26863446
  35. Correlate ERBB3 gene SNPs with rheumatoid arthritis susceptibility. PMID: 25530448
  36. Nrdp1S is a tumour suppressor that which potentiates the Nrdp1-mediated ubiquitination and degradation of ErbB3. An Nrdp1S deficiency may also be an important factor in the loss of Nrdp1. PMID: 26612725
  37. In response to trastuzumab, both HER3 and the metalloprotease ADAM10 are simultaneously upregulated. The proteolytic activity of the latter then releases the HER3 ligand heregulin from the cell surface to activate HER3 and confer resistance to trastuzumab by inducing compensatory growth factor receptor signaling. PMID: 26863569
  38. the identification of HER3-V855A and its functional properties for the first time clearly implicates genomic HER3 activation in the pathogenesis of lung cancer. PMID: 26689995
  39. These data indicate that erbB3 signaling is critical for both trastuzumab and lapatinib resistances mainly through the PI-3K/Akt pathway, whereas IGF-1R-initiated Src activation results in trastuzumab resistance without affecting lapatinib sensitivity. PMID: 26621843
  40. Data show that heat shock protein 90 (HSP90) inhibitor 17-DMAG caused loss of ret proto-oncogene protein (RET) and proto-oncogene protein erbB-3 (ERBB3) phosphorylation and lead to rapid cell death. PMID: 26595521
  41. Data indicate the role of proto-oncogene protein erbB-3 (ErbB3) in hepatitis B virus X protein (HBx)-mediated cell survival. PMID: 26595522
  42. our results suggest that HER3 over-expression may be associated with worse overall survival in gastric cancers PMID: 26517355
  43. Study shows that ERBB3 is a novel regulator of beta-cell apoptosis and found rs2292239 strongly correlated with residual b-cell function and metabolic control in children with type 1 diabetes. PMID: 26450151
  44. Authors show experimental evidence for an ErbB3 gain-of-function point mutation located in the C-lobe asymmetric dimerization interface, which shows enhanced phosphorylation at low ligand dose associated with increased kinase activity. PMID: 26378253
  45. HER2/HER3 interaction and increased expression was linked to risk for poor outcome in lung cancer patients. PMID: 26678909
  46. Data show that cotreatment with anti-ERBB3 proto-oncogene protein antibody seribantumab and letrozole had increased antitumor activity. PMID: 26310543
  47. HPV 16 E2 can modulate ErbB-3 by interacting with Nrdp-1, which is involved in the regulation of this receptor, via ubiquitination and degradation. PMID: 26963794
  48. findings show that the local 3D tumor microenvironment can trigger reprograming and switching of ErbB family members and thereby influence ErbB3-driven tumor growth PMID: 26073080
  49. ERa-dependent expression of LRIG1 dampens ErbB3 signaling in luminal breast cancer cells, and by blocking ERa activity with fulvestrant, LRIG1 is decreased thus permitting ErbB3 accumulation, enhanced ErbB3 signaling to cell survival pathways PMID: 26148232
  50. Data indicate that clathrin-mediated endocytosis of proto-oncogene protein erbB-3 (ErbB3) is depending on epsin-1. PMID: 26975582

Show More

Hide All

Involvement in disease
Lethal congenital contracture syndrome 2 (LCCS2)
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.
Protein Families
Protein kinase superfamily, Tyr protein kinase family, EGF receptor subfamily
Tissue Specificity
Epithelial tissues and brain.
Database Links

HGNC: 3431

OMIM: 190151

KEGG: hsa:2065

STRING: 9606.ENSP00000267101

UniGene: Hs.118681

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*