Code | CSB-MP007765HU |
Size | $298 How to order? |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
CUSABIO used a DNA fragment (encoding amino acid 20-643 of the human ERBB3) with a C-terminal hFc-tag to generate the recombinant human ERBB3 protein in mammalian cells. This ERBB3 protein was subjected to SDS-PAGE under reducing conditions and presented a molecular mass band of about 115kDa on the gel. Its purity is greater than 95%. The endotoxin content is less than 1.0 EU/ug determined by the LAL method. It has been identified as an active protein through its binding ability with the NRG1 in the functional ELISA. The EC50 is 12.32-15.74 ng/ml. And it is in stock now. Upon binding to its receptors neuregulins (NRGs), ErBB3 forms heterodimers with other ErBB receptors and triggers phosphorylation cascades that promote crucial cellular functions, including proliferation, differentiation, and survival. ErBB3 also plays an important role in the regulation of cancer progression and therapeutic resistance. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized NRG1(CSB-MP016077HU1(F6)) at 2 μg/ml can bind human ERBB3, the EC50 is 12.32-15.74 ng/ml. |
Target Names | ERBB3 |
Uniprot No. | P21860 |
Alternative Names | (Proto-oncogene-like protein c-ErbB-3)(Tyrosine kinase-type cell surface receptor HER3)(HER3) |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 20-643aa |
Target Protein Sequence | SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLT |
Mol. Weight | 96.4 kDa |
Protein Length | Partial |
Tag Info |
C-terminal hFc-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Tyrosine-protein kinase that plays an essential role as cell surface receptor for neuregulins. Binds to neuregulin-1 (NRG1) and is activated by it; ligand-binding increases phosphorylation on tyrosine residues and promotes its association with the p85 subunit of phosphatidylinositol 3-kinase. May also be activated by CSPG5. Involved in the regulation of myeloid cell differentiation.
|
Gene References into Functions |
|
Involvement in disease | Lethal congenital contracture syndrome 2 (LCCS2) |
Subcellular Location | [Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted. |
Protein Families | Protein kinase superfamily, Tyr protein kinase family, EGF receptor subfamily |
Tissue Specificity | Epithelial tissues and brain. |
Database Links |
HGNC: 3431 OMIM: 190151 KEGG: hsa:2065 STRING: 9606.ENSP00000267101 UniGene: Hs.118681 |