Recombinant Apis mellifera Vitellogenin (Vg), partial

In Stock
Code CSB-EP768142DNK
Abbreviation Recombinant Apis mellifera Vitellogenin protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Vg
Uniprot No.
Research Area
Others
Species
Apis mellifera (Honeybee)
Source
E.coli
Expression Region
1439-1672aa
Target Protein Sequence
EDETSCMLDKTRAQTFDGKDYPLRLGPCWHAVMTTYPRINPDNHNEKLHIPKDKSVSVLSRENEAGQKEVKVLLGSDKIKFVPGTTSQPEVFVNGEKIVVSRNKAYQKVEENEIIFEIYKMGDRFIGLTSDKFDVSLALDGERVMLKASEDYRYSVRGLCGNFDHDSTNDFVGPKNCLFRKPEHFVASYALISNQCEGDSLNVAKSLQDHDCIRQERTQQRNVISDSESGRLDT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.5 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Precursor of the egg-yolk proteins that are sources of nutrients during embryonic development. Involved in the differentiation of honeybee larvae into queens.
Gene References into Functions
  1. A tight coregulatory relationship exists between Vg and juvenile hormone (JH) in the regulation of honeybee behavioral maturation that is manifest at the genomic level; acting through common pathways, they regulate brain gene expression and behavior. PMID: 23889463
  2. The study demonstrates a causal link between the Vg knockdown forager phenotype and variation in the abundance of microRNAs in different tissues, with possible consequences for the regulation of foraging behavior. PMID: 23788711
  3. spectroscopic results strengthen our model of the Vg polyserine tract as a flexible domain linker shielded by phosphorylation PMID: 22573762
  4. identify vitellogenin protein in the hypopharyngeal glands (brood food producing head glands) of nursing worker bees and in adjacent head fat body cells for the first time PMID: 20337562
  5. Data show that silencing of vitellogenin expression causes a significant increase in juvenile hormone titer and its putative receptor. PMID: 16122739
  6. Vitellogenin protein, which is synthesized at high levels in honey bee queens and is abundant in long-lived workers, protects worker bees from oxidative stress PMID: 16418279
  7. In precocious foragers, downregulation of vitellogenin gene activity apparently has little effect on the juvenile hormone titer. PMID: 18545981
  8. Workers in the queenless colonies with active ovaries that have an upregulation of vit transcript expression levels, and thus assumed vitellogenin protein levels. PMID: 19096928
  9. Bacteria- or water-injection induce an equivalent and strong depression in the levels of Vg protein, which was corroborated in M. luteus-injected bees, but not in S. marcescens-injected ones, by a statistically significant decrease in vg mRNA levels. PMID: 19309002

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Accumulates in the hemolymph. Represents up to 70% of the queen's hemolymph proteins. During the first week of the worker adult life, when it becomes a nurse bee and performs brood-rearing tasks, the vitellogenin titer increases and may account for up to
Database Links

KEGG: ame:406088

UniGene: Ame.206

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*