Recombinant Macaca fascicularis Interleukin-4 (IL4)

In Stock
Code CSB-YP301281MOV
Abbreviation Recombinant Cynomolgus monkey IL4 protein
MSDS
Size US$436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Left. 35 kDa.
    Right. 16.9 kDa by EndoH digestion
    The reducing (R) protein migrates as 35 kDa in SDS-PAGE due to glycosylation.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP301281MOV could indicate that this peptide derived from Yeast-expressed Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) IL4.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP301281MOV could indicate that this peptide derived from Yeast-expressed Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) IL4.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
IL4Interleukin-4; IL-4; B-cell stimulatory factor 1; BSF-1; Lymphocyte stimulatory factor 1
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Yeast
Expression Region
25-153aa
Target Protein Sequence
HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression of recombinant Macaca fascicularis IL4 protein includes the construction of the expression vector containing the recombinant DNA and the transformation of the expression vector into the yeast, which provides a variety of macromolecules and components required for transcription and translation. The recombinant DNA was formed by fusing the N-terminal 6xHis tag sequence to the designated sequence encoding the 25-153aa of the Macaca fascicularis IL4 protein. This N-terminal 6xHis-tagged recombinant Macaca fascicularis IL4 protein is also characterized by high purity, >90%. Under SDS-PAGE condition, this recombinant IL4 protein migrated to the bands of about 30 kDa and 17 kDa molecular weight, corresponding to the glycosylated and deglycosylated forms, respectively.

As the B cell-stimulatory factor-1, IL-4 is mainly produced by activated T cells. In T-cells, IL-4 induces the differentiation of naïve CD4 T cells into Th2 cells, in B cells, IL-4 drives the immunoglobulin (Ig) class switch to IgG1 and IgE, and in macrophages, IL-4 and IL-13 induce alternative macrophage activation. It has been well-documented that it plays a major role in hormone control and adaptive immunity. In addition, IL-4 a key regulator in inflammation response and wound repair. Many papers give insights into the functional formation of IL-4. Studies found that IL-4 coordinates the Th2-type immune response in inflammatory diseases such as asthma. IL-27 can inhibit the development of both Th2 and Th1. Prolonged residence of an albumin–IL-4-fusion protein in secondary lymphoid organs ameliorates experimental autoimmune encephalomyelitis. IL-4 absence could trigger the distinct pathways in apical periodontitis development. Association between IL-4 gene polymorphisms and IL-4 serum levels in patients with allergic rhinitis. Status of IL‐4 and IL‐10 driven markers in experimental models of visceral leishmaniasis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages. Stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4.
Subcellular Location
Secreted.
Protein Families
IL-4/IL-13 family
Database Links

UniGene: Mfa.6178

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*