Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
ALPS2B; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein; Apoptosis related cysteine peptidase; Apoptotic cysteine protease; Apoptotic protease Mch-5; Apoptotic protease Mch5; CAP 4; CAP4; CASP-8; CASP8; CASP8_HUMAN; Caspase 8; Caspase 8 apoptosis related cysteine peptidase; Caspase IIX; Caspase-8 subunit p10; caspase8; CED 3; FADD Homologous ICE/CED3 Like Protease; FADD Like ICE; FADD-homologous ICE/CED-3-like protease; FADD-like ICE; FLICE; FLJ17672; ICE-like apoptotic protease 5; MACH alpha 1/2/3 protein; MACH; MACH beta 1/2/3/4 protein; MACH5; MCH 5; MCH5; MGC78473; MORT1 associated ced 3 homolog; MORT1 associated CED3 homolog; MORT1-associated CED-3 homolog; OTTHUMP00000163717; OTTHUMP00000163720; OTTHUMP00000163724; OTTHUMP00000163725; OTTHUMP00000165062; OTTHUMP00000165063; OTTHUMP00000165064; OTTHUMP00000206552; OTTHUMP00000206582
Species
Homo sapiens (Human)
Expression Region
217–374aa
Target Protein Sequence
SESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Our Recombinant Human CASP8 protein provides an exceptional tool for the study of apoptosis and related biological processes. Caspase-8, or CASP-8, is a crucial component in the extrinsic apoptotic pathway, functioning as an initiator caspase to promote cell death. Sourced from E. coli, this product encompasses a partial CASP8 protein sequence (217-374aa) and features an N-terminal 6xHis tag for efficient protein purification and detection.
The Recombinant Human CASP8 protein boasts a purity greater than 90% as determined by SDS-PAGE, ensuring the highest quality for your apoptosis research. Supplied as a lyophilized powder, our CASP8 protein delivers consistent and reliable results, facilitating in-depth investigation of cell death mechanisms, cancer biology, and other apoptotic pathways.