Recombinant Human Caspase-8(CASP8),partial

In Stock
Code CSB-RP181094h(A3)
Size US$657
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names CASP8
Uniprot No. Q14790
Research Area Apoptosis
Alternative Names ALPS2B; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein; Apoptosis related cysteine peptidase; Apoptotic cysteine protease; Apoptotic protease Mch-5; Apoptotic protease Mch5; CAP 4; CAP4; CASP-8; CASP8; CASP8_HUMAN; Caspase 8; Caspase 8 apoptosis related cysteine peptidase; Caspase IIX; Caspase-8 subunit p10; caspase8; CED 3; FADD Homologous ICE/CED3 Like Protease; FADD Like ICE; FADD-homologous ICE/CED-3-like protease; FADD-like ICE; FLICE; FLJ17672; ICE-like apoptotic protease 5; MACH alpha 1/2/3 protein; MACH; MACH beta 1/2/3/4 protein; MACH5; MCH 5; MCH5; MGC78473; MORT1 associated ced 3 homolog; MORT1 associated CED3 homolog; MORT1-associated CED-3 homolog; OTTHUMP00000163717; OTTHUMP00000163720; OTTHUMP00000163724; OTTHUMP00000163725; OTTHUMP00000165062; OTTHUMP00000165063; OTTHUMP00000165064; OTTHUMP00000206552; OTTHUMP00000206582
Species Homo sapiens (Human)
Source E.coli
Expression Region 217–374aa
Target Protein Sequence SESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 21.9kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Most upstream protease of the activation cascade of caspases responsible for the TNFRSF6/FAS mediated and TNFRSF1A induced cell death. Binding to the adapter molecule FADD recruits it to either receptor. The resulting aggregate called death-inducing signaling complex (DISC) performs CASP8 proteolytic activation. The active dimeric enzyme is then liberated from the DISC and free to activate downstream apoptotic proteases. Proteolytic fragments of the N-terminal propeptide (termed CAP3, CAP5 and CAP6) are likely retained in the DISC. Cleaves and activates CASP3, CASP4, CASP6, CASP7, CASP9 and CASP10. May participate in the GZMB apoptotic pathways. Cleaves ADPRT. Hydrolyzes the small-molecule substrate, Ac-Asp-Glu-Val-Asp-|-AMC. Likely target for the cowpox virus CRMA death inhibitory protein. Isoform 5, isoform 6, isoform 7 and isoform 8 lack the catalytic site and may interfere with the pro-apoptotic activity of the complex.
Gene References into Functions
  1. The caspase 8 mediated RIPK1 cleavage product has a pro-apoptotic function, and further cleavage of this pro-apoptotic cleavage product by human rhinovirus 3C protease may provide a mechanism by which human rhinovirus limits apoptosis. PMID: 29371673
  2. results suggest that miR-21 regulates the apoptosis of keloid fibroblasts via targeting FasL, and caspase-8 and the mitochondria-mediated apoptotic signaling pathway is involved in this process. PMID: 29527928
  3. neither rs13416436 nor rs2037815 associated with pre-eclampsia PMID: 28110598
  4. High CASP8 expression is associated with Colorectal Cancer. PMID: 29801534
  5. Sleep duration is associated with plasma caspase-8. Caspase-8 independently predicts diabetes mellitus years before disease onset and modifies the effect of sleep duration on incident diabetes mellitus. PMID: 29409058
  6. Reactive oxygen species-induced cleavage of NHLRC2 by caspase-8 leads to apoptotic cell death in the HCT116 human colon cancer cells. PMID: 29242562
  7. this study is the first report on reduced expression of CASP8 in breast cancer versus adjacent normal tissues. PMID: 29233452
  8. The polymorphisms of CASP8, rs7608692, and haplotype AGAACAG correlated with neutropenia toxicity. The haplotype GGGGAAA was associated with thrombocytopenia toxicity. We conclude that the polymorphisms of CASP8 contribute to the prognosis of advanced lung adenocarcinoma and influence the quality of life and survival. PMID: 28278082
  9. These results indicated that cMyc and Fas regulated the sensitivity of A549 cells to irradiation by regulating caspase8-mediated Bid activation and the subsequent association with the mitochondrial pathway of apoptosis. PMID: 28849062
  10. miR-21 was elevated in osteosarcoma, and overexpression of miR-21 suppressed apoptosis via targeting caspase 8. PMID: 28109080
  11. Our findings indicate the relationship of SNP CASP8 D302H and breast cancer would not be universal but only be sensitive in some particular European countries. PMID: 28674227
  12. no mutations were detected in the CASP8 gene, but we observed a frequent [32/48 (66.6%)] SNP [rs1045487] in the oral cancer samples. PMID: 28181739
  13. case-control study, including 600 hepatocellular carcinoma (HCC) and 600 HBsAg positive controls without HCC, was conducted to assess the relationship between 11 tagging SNPs in CASP8, CASP10 and CFLAR and HBV-related HCC risk .These results suggest that the CASP8 -652 6N ins/del polymorphism may play a protective role in the development, progression, and survival of HBV-related HCC among the Chinese Han population. PMID: 28643196
  14. High caspase-8 is not significantly associated with adverse breast cancer-specific survival. No associations were observed between caspase-8 and clinicopathological criteria. PMID: 27798717
  15. we found that plumbagin could enhance TRAIL-induced apoptosis in Kasumi-1 cells, and the mechanisms include ROS-mediated upregulation of DR5 expression, caspase-8 activation and inhibition of cFLIP expression PMID: 28498435
  16. this study shows that mitochondrial DNA oxidation induces imbalanced activity of NLRP3/NLRP6 inflammasomes by activation of caspase-8 and BRCC36 in dry eye PMID: 28238526
  17. Importantly, the bioinformatics analysis of microarray gene expression data derived from a set of high-grade human gliomas, shows that high Caspase-8 expression levels correlate with a worse prognosis. PMID: 28594322
  18. this review describes the role of caspase-8 in the initiation of extrinsic apoptosis execution and the mechanism by which caspase-8 inhibits necroptosis PMID: 28462525
  19. Data indicate that elevated levels of Polo-like kinase 3 (Plk3)and pT273 caspase-8 are correlated with favorable clinical outcome in patients with anal squamous cell carcinoma (anal SCC) treated with concomitant chemoradiotherapy (CRT). PMID: 27462786
  20. Caspase-8 binding via FADD to the receptor is an indispensable initiating step in death-inducing signaling complex formation and NF-kB activation. PMID: 28445729
  21. The procaspase-8 Q482H mutation in AML patients abolishes caspase-8-mediated apoptosis by impairing procaspase-8 dimerization. PMID: 29191655
  22. These findings suggest that intracellular cholesterol level affects TMZ treatment of GBM mediated via a DR5-caspase-8 mechanism. PMID: 29162448
  23. study shows genetic association of rare variants in CASP8 with Alzheimer's disease and proposes a mechanism of action mediated by decreased enzyme activity; for two CASP8 variants, p.K148R and p.I298V, the association remained significant in a large combined sample PMID: 28985224
  24. Knockout (KO) or knockdown of caspase-8, CD95 or FADD prevents activation of Plk3 upon CD95 stimulation, suggesting a requirement of a functional death-inducing signaling complex for Plk3 activation. PMID: 27325299
  25. SP-D increases the formation of nuclear and membrane blebs. Inhibition of caspase-8 confirms the effect of SP-D is unique to the caspase-8 pathway. PMID: 29107869
  26. Results illustrate the temporal and spatial activation of caspase-8 and -3 in microglia/macrophages occurring upon ischemic stroke and suggest that the expression of these caspases could be used in neuropathological diagnostic work. PMID: 27566702
  27. This is the first report, showing negative and independent prognostic impact of the CASP8 -652 6N Del and the 302His variant for breast cancer. PMID: 27507139
  28. Data suggest that pro-death signals through TIR-domain-containing adapter-inducing interferon-beta (TRIF) are regulated by autophagy and propose that pro-apoptotic signalling through TRIF/RIPK1/caspase-8 occurs in fibrillary platforms. PMID: 28453927
  29. caspase-8-dependent apoptosis was linked to hepatocellular carcinoma development. PMID: 28898696
  30. Insertion genotype of CASP8 rs3834129 polymorphisms showed risk in CAD. CASP8 rs3769818 activates intronic cryptic donor. PMID: 28633917
  31. Caspase-8 controls the secretion of inflammatory lysyl-tRNA synthetase in exosomes from colorectal cancer cells. PMID: 28611052
  32. Fisetin inhibited Triple-Negative Breast Cancer Cells cell division and induced apoptosis, which was associated with mitochondrial membrane permeabilization and the activation of caspase-9 and caspase-8, as well as the cleavage of poly(ADP-ribose) polymerase-1. PMID: 26755433
  33. Caspase-8 can serve in two distinct roles in response to TRAIL receptor engagement, as a scaffold for assembly of a Caspase-8-FADD-RIPK1 "FADDosome" complex, leading to NFkappaB-dependent inflammation, or as a protease that promotes apoptosis. PMID: 28212752
  34. Using the tDED filament structure as a template, structural analyses reveal the interaction surfaces between FADD and caspase-8 and the distinct mechanisms of regulation by cFLIP and MC159 through comingling and capping, respectively. PMID: 27746017
  35. our novel findings expand our understanding of the key mechanisms underlying the anti-apoptotic functions of caspase-8 which may act as a critical block to existing antitumour therapies. PMID: 27109099
  36. Dasatinib, a c-Src inhibitor, dephosphorylated caspase-8 to facilitate necroptosis, rather than apoptosis, in paclitaxel-treated p-Casp8-expressing lung adenocarcinoma cells. PMID: 27195913
  37. Loss of function mutations in FAT1 and CASP8 prevent cell adhesion and promote cell migration and proliferation in oral squamous cell carcinoma cell lines. PMID: 27693639
  38. Dysregulation of a potassium channel, THIK-1, targeted by caspase-8, accelerates cell shrinkage. PMID: 27566292
  39. caspase-8 and caspase-9 contribute to the cyclic stretch-induced apoptosis, but functioned differently at different stages in human periodontal ligament cells PMID: 27942018
  40. Down-regulation of mRNA expression was found in cases in which CASP8, TMS1 and DAPK were hypermethylated. PMID: 28361856
  41. sorafenib overcomes TRAIL resistance in renal cell carcinoma by a mechanism that does not rely on Mcl-1 down-regulation but involves ROS accumulation and increased activation of caspase-8 PMID: 28154184
  42. autoinflammation-associated H443P nlrc4 mutant is altered in interaction with SUG1 and ubiquitinated proteins, triggering constitutive caspase-8-mediated cell death dependent on FADD but independent of Ser(533) phosphorylation. PMID: 27974463
  43. Caspase-8 is phosphorylated on Tyr380 in a Src kinase dependent manner and this phosphorylation is required for transformation and it is enhanced by hypoxic conditions. PMID: 27432652
  44. Our results revealed that caspase-8 gene silencing may result from the methylation of its gene promoter in human glioma tissues. The expression of caspase-8 at the mRNA level was significantly associated with the grade of human glioma. PMID: 28204824
  45. Suggest that caspase 8 SNPs were not associated with rheumatoid arthritis. PMID: 26905515
  46. novel dynamic interplay between Src and caspase-8 likely acts as a potent signal-integrating switch directing the cell towards apoptosis or survival PMID: 27101103
  47. Findings showed that, in MDA-MB-231 cells, casp-8 might play some unusual roles which should be better explored, in order to understand whether it might be identified as a molecular therapeutic target. PMID: 27082853
  48. Study showed that TRAIL and caspase-8 expression decreased in human osteosarcoma, resulting in increased cell proliferation, and reduced cell apoptosis suggesting they play important roles in the occurrence, development, and prognosis of osteosarcoma. PMID: 28002586
  49. evidence that Articulatin-D efficiently activates caspase-8 involved in extrinsic pathway of apoptosis induction, which ultimately results in caspase-3-dependent DNA fragmentation of Jurkat cells. PMID: 27868169
  50. our findings indicate that the expression levels of P-GP, MYC, caspase-8, and AKT3 are candidate biomarkers of cell sensitivity to PLKis. PMID: 27699933
  51. Overexpression of CASP8 is associated with lung cancer. PMID: 27465556
  52. Thymoquinone inhibitory effects were associated with inhibition of NF-kappaB and altered expression of its downstream effectors IL-8 and its receptors, the anti-apoptotic Bcl-2, Bcl-xL, X-IAP, and FLIP, as well as the pro-apoptotic TRAIL-R1, caspase-8, caspase-9, Bcl-xS, and cytochrome c. PMID: 27084536
  53. Direct non-homotypic interactions of HPV18 E2 transactivation domain (TAD) with alpha2/alpha5 helices of procaspase-8 death effector domain-B (DED-B) mediate cell death in HEK293 cells. PMID: 26906543
  54. CASP8 rs3769823 and IDH2 rs4561444 were as the potential functional variants in high-linkage disequilibrium with these single nucleotide polymorphisms, respectively. The IDH2 mRNA levels were down-regulated in oesophageal squamous cell carcinoma. PMID: 26635288
  55. The CASP8 rs700635[C] allele, which is associated with increased risk of cutaneous basal-cell carcinoma and breast cancer, is protective against prostate cancer. PMID: 26740556
  56. neither c-FLIP nor procaspase-8 prodomain terminates the DED chain, but rather the dissociation/association rates of procaspase-8 define the stability of the chain and thereby its length. PMID: 26494467
  57. Data show that tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced endoplasmic reticulum (ER) stress was triggered by caspase-8-mediated cleavage of B cell receptor-associated protein 31 (BAP31). PMID: 26212606
  58. Data show that when death receptor 5 (DR5) is suppressed, caspase-8 may recruit and stabilize TNF receptor-associated factor 2 (TRAF2) to form a metastasis and invasion signaling complex, resulting in activation of ERK signaling. PMID: 26510914
  59. we conclude that some SNPs in CASP8 are associated with subtype-specific breast cancer risk. This study contributes to our understanding of CASP8 SNPs and breast cancer risk by subtype. PMID: 26758508
  60. Frequencies of SNPs rs2234978 and rs1045487 of FAS and CASP8 genes were significantly higher in Autoimmune Lymphoproliferative Syndrome patients. PMID: 26690594
  61. procaspase-8:c-FLIPL exhibits localized enzymatic activity and is preferentially an activator, promoting DED-mediated procaspase-8 oligomer assembly, whereas procaspase-8:c-FLIPS lacks activity and potently blocks procaspase-8 activation PMID: 26990987
  62. A20 targets caspase-8 and FADD to protect HTLV-I-infected cells. PMID: 26437781
  63. procaspase-8 death effector domain chain that is crucial for its activation and subsequent cell death PMID: 26370846
  64. Studied the mechanism of Artemisinin (ARTE)-induced human lung adenocarcinoma (ASTC-a-1) cell apoptosis; results showed ARTE induced the activation of caspase-3, -8 and -9. PMID: 25214386
  65. ASC induces procaspase-8 death effector domain filaments PMID: 26468282
  66. rs13014235[C] is associated with susceptibility to cutaneous basal cell carcinoma. PMID: 25855136
  67. A frame-shift and a novel missense mutation in CASP8 gene is associated with oral Squamous Cell Carcinoma. PMID: 26107208
  68. in the absence of caspase-8 activity, 24(S)-Hydroxycholesterol induces a necroptosis-like cell death which is RIPK1-dependent but MLKL-independent. PMID: 25697054
  69. a novel small molecule that not only stimulates TRAIL-induced apoptosis in cancer cells, but may also provide insights into the structure-function relationship of caspase 8 homodimers as putative targets in cancer. PMID: 25962125
  70. The phylogenetic distribution of caspase-8, the initiator caspase of the extrinsic apoptotic pathway. [Review] PMID: 26010168
  71. Authors observed that the extracellular region of the EphA7 receptor was critical for interacting with caspase-8, whereas the cytoplasmic region of EphA7 was not. PMID: 25855521
  72. Casp8-dependent migration of enterocytes is likely involved in intestinal physiology and inflammation-related pathophysiology. PMID: 25914458
  73. CASP8 SNP D302H (rs1045485) is associated with worse survival in MYCN-amplified neuroblastoma patients PMID: 25502557
  74. These data imply an unrecognized role for the CASP8 promoter polymorphism on survival following unrelated SCT particularly in the context of T-cell depletion with Alemtuzumab. PMID: 25347010
  75. review of caspase-8 and its role in modulating IL-1beta and inflammation [review] PMID: 25451151
  76. Genetic variations within the CASP8 gene are biomarkers for cancer risk. PMID: 25553350
  77. The study reports the first crystal structure of the death effector domains of caspase-8. PMID: 26003730
  78. Genome-wide association studies show a significant association between the intronic SNP rs1830298 in ALS2CR12 gene and breast cancer; further expression studies suggest that CASP8 might be the target gene. PMID: 25168388
  79. data strongly indicate that the inhibition of ceramide conversion to complex sphingolipids by D609 is accompanied by an enhancement of FasL-induced caspase-dependent and -independent cell death in T lymphocytes. PMID: 22942738
  80. LtxA kills malignant lymphocytes by a novel mechanism requiring the death receptor Fas and caspase-8 PMID: 25850729
  81. Knock-down of caspase 8 expression lead to inhibition of hMSCs apoptosis, reduction of caspase 8 activity and up-regulations of HGF, IGF-1 and Bcl-2. PMID: 25060909
  82. siRNA-based gene inactivation of caspase-8 effectively delays caspase-9 activation and apoptosis induced by G-Rh2, indicating that caspase-8 also plays an important role in the G-Rh2-induced apoptosis program. PMID: 23443079
  83. RIPK1 indirectly regulates caspase-8 activation, in part via interaction with the ER stress sensor IRE1. PMID: 25476903
  84. Caspase-8 -652 6N del and D302H polymorphisms are associated with prostate cancer in different ethnic groups. PMID: 25292051
  85. Data show that the signals of cytoplasmic cyclin-dependent kinase inhibitor 1B (p27) and caspase 8 increased and merged together after gefitinib treatment. PMID: 25228008
  86. Three of the four procaspase-8 mutants promoted enhanced cellular migration and invasion through matrigel, relative to that seen with the wild-type procaspase-8 protein. PMID: 24816188
  87. these results demonstrate that mitochondrial apoptosis is not required for NLRP3 activation, and highlight an important non-apoptotic role for caspase-8 in regulating inflammasome activation and pro-inflammatory cytokine levels. PMID: 24990442
  88. no association between CASP8 gene polymorphisms with immunoglobulin A nephropathy PMID: 24621205
  89. Mechanisms mediating TNFSF15:DR3 contributions to pattern recognition receptor outcomes included TACE-induced TNFSF15 cleavage to soluble TNFSF15; soluble TNFSF15 then led to TRADD/FADD/MALT-1- and caspase-8-mediated autocrine IL-1 secretion. PMID: 25197060
  90. contributes to dysfunctional proliferation of HIV-specific CD8+ T cells PMID: 25526311
  91. DICER1/Alu RNA dysmetabolism induces Caspase-8-mediated cell death in age-related macular degeneration. PMID: 25349431
  92. TIPE2 can regulate TLR4 inflammatory effect and inhibit further amplification of cascade reaction via caspase-8. PMID: 24934366
  93. RIPK3 serves as a negative regulator of selective autophagy by regulating regulates p62-LC3 complex formation via the caspase-8-dependent cleavage of p62 PMID: 25450619
  94. caspase-8 and LC3 are ubiquinated and have roles in 2',3'-dimethoxyflavanone-induced apoptosis in breast cancer stem cells PMID: 25132643
  95. our results indicate that the mechanism by which PAR-4 orchestrates the apoptotic process requires cleavage by caspase-8. PMID: 24931006
  96. The study reveals a novel pathway for FLIP regulation of NF-kappaB through protein S-nitrosylation, which is a key posttranslational mechanism controlling DR-mediated cell death and survival. PMID: 24762656
  97. A second CASP8 promoter was identified located upstream of the caspase-8 isoform G. PMID: 24819879
  98. Fas-Fas-ligand signal transduction could be inhibited, especially at the stage of caspase-8 activation, thereby establishing a major mechanism for evasion of apoptosis by these tumors PMID: 24561085
  99. Procaspase-8 is regulated during the cell cycle through the concerted inhibitory action of Cdk1/cyclin B1 and polo-like kinase 1 (Plk1). PMID: 24484936
  100. the functional polymorphism CASP8 rs1035142 G>T might contribute to ESCC susceptibility. PMID: 24464182

Show More

Hide All

Involvement in disease Caspase-8 deficiency (CASP8D)
Subcellular Location Cytoplasm
Protein Families Peptidase C14A family
Tissue Specificity Isoform 1, isoform 5 and isoform 7 are expressed in a wide variety of tissues. Highest expression in peripheral blood leukocytes, spleen, thymus and liver. Barely detectable in brain, testis and skeletal muscle.
Database Links

HGNC: 1509

OMIM: 211980

KEGG: hsa:841

STRING: 9606.ENSP00000351273

UniGene: Hs.599762

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1