Recombinant Human Coagulation factor V(F5),partial

Code CSB-EP007929HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P12259
Relevance Central regulator of hostasis. It serves as a critical cofactor for the prothrombinase activity of factor Xa that results in the activation of prothrombin to thrombin.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP007929HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) F5.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP007929HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) F5.
Storage Buffer Tris-based buffer,50% glycerol
Alias Activated protein C cofactorProaccelerin, labile factor
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTT
Research Area Cardiovascular
Source E.coli
Gene Names F5
Protein Names Recommended name: Coagulation factor V Alternative name(s): Activated protein C cofactor Proaccelerin, labile factor Cleaved into the following 2 chains: 1. Coagulation factor V heavy chain 2. Coagulation factor V light chain
Expression Region 1490-1614aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 30.4kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Central regulator of hemostasis. It serves as a critical cofactor for the prothrombinase activity of factor Xa that results in the activation of prothrombin to thrombin.
Involvement in disease Factor V deficiency (FA5D); Thrombophilia due to activated protein C resistance (THPH2); Budd-Chiari syndrome (BDCHS); Ischemic stroke (ISCHSTR); Pregnancy loss, recurrent, 1 (RPRGL1)
Subcellular Location Secreted
Protein Families Multicopper oxidase family
Tissue Specificity Plasma.
Database Links

HGNC: 3542

OMIM: 188055

KEGG: hsa:2153

STRING: 9606.ENSP00000356771

UniGene: Hs.30054

Pathway Complement and coagulation cascades

Related Products

F5 Antibodies

F5 Antibodies for Human

F5 Proteins

F5 Proteins for Homo sapiens (Human)

F5 ELISA Kit

F5 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.