Recombinant Human Coagulation factor V (F5), partial

In Stock Promotion
Code CSB-EP007929HU
Abbreviation Recombinant Human F5 protein, partial
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP007929HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) F5.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP007929HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) F5.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Activated protein C cofactor; APC cofactor; coagulation factor V (proaccelerin; labile factor); Coagulation factor V; coagulation factor V jinjiang A2 domain; Coagulation factor V light chain; F5; FA5_HUMAN; Factor V Leiden; FactorV; FVL; Labile factor; PCCF; Proaccelerin; proaccelerin; labile factor; Protein C cofactor; RPRGL1; THPH2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1490-1614aa
Target Protein Sequence
MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.4kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The Recombinant Human F5 protein is a crucial tool for understanding coagulation processes and exploring potential therapeutic interventions in cardiovascular research. Coagulation factor V, also known as activated protein C cofactor, is an essential player in the blood clotting cascade, regulating the balance between procoagulant and anticoagulant activities.

This product contains a partial sequence of the human F5 protein (1490-1614aa) expressed in E.coli, ensuring high-quality recombinant protein production. The N-terminal 6xHis-SUMO tag enables efficient purification and facilitates detection in downstream applications. With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Human F5 protein provides a reliable reagent for your cardiovascular research needs. Supplied as a lyophilized powder, this product is readily reconstituted for immediate use in your experiments.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Central regulator of hemostasis. It serves as a critical cofactor for the prothrombinase activity of factor Xa that results in the activation of prothrombin to thrombin.
Gene References into Functions
  1. factor V Leiden and MTHFR C677T polymorphisms were significantly associated with recurrent pregnancy loss (RPL) in Bosnian women... PMID: 29703881
  2. study found the FVL A allele frequency and GA genotype are significantly more prevalent among patients with coronary artery disease (CAD) compared to controls and may be predisposing to CAD; further found that the FVL mutation is an independent risk factor whose effect is not modified by other risk factors; FV HR2 variation does not show any statistically significant association with CAD PMID: 29179580
  3. suggesting that the FVL paradox is related to the carriership of one wild type and one mutated factor V allele PMID: 29320959
  4. Review/Meta-analysis: Factor V G1691A single nucleotide gene polymorphism was associated with risk of ischemic stroke mainly in young adults. PMID: 29478939
  5. Factor V Leiden mutation is associated with venous thromboembolism in cancer. PMID: 29775482
  6. Human FVL carriers have a higher total sperm count than non-carriers, with an adjusted mean difference of 31 x 106 (95%CI 0.2-61.7; P = 0.048). PMID: 28927238
  7. contribution of FVLeiden causing resistance to activated protein C in Indian population is not as strong as previously reported in Western countries PMID: 26699866
  8. The frequencies of GA and AA genotypes and A allele of coagulation factor V (FV) 1691G>A polymorphism significantly increased in the lower extremity deep venous thrombosis (LDVT) group. Patients with LDVT carrying A allele (GA + AA) had both higher patency and recurrence rates than those carrying GG genotype. Coagulation factor V (FV) 1691G>A polymorphism may be associated with both the risk and prognosis of LDVT. PMID: 29851809
  9. Factor V Leiden-mutations were found in 16.8% of patients with cerebral sinus venous thrombosis and in 17.8% of patients with arterial ischemic stroke, which was significantly more frequent than in controls at a rate of 4.95% (ORs: 3.89 and 4.16). PMID: 28869458
  10. Double heterozygotes had a clinical presentation intermediate between FVL and prothrombin mutation single carriers. PMID: 28577389
  11. genetic study of Factor V Leiden (G1691A) mutation in young ischemic strokes with large vessel disease in a South Indian population PMID: 28711293
  12. results suggest that some SNPs of F5 and a high or low FV:C level might be associated with recurrent miscarriage PMID: 27655299
  13. FVBonn induces hypercoagulability via a combination of increased activation/procoagulant activity, decreased susceptibility to Activated protein C-mediated inactivation, and slightly reduced APC cofactor activity PMID: 27090446
  14. Heterozygous FV Leiden, homozygous PAI-1 4G/4G, heterozygous MTHFR C677T, homozygous MTHFR A1298C, as much as the combined thrombophilic genotypes MTHFR 677T + ACE Iota/D, MTHFR 677T/1298C + ACE D/D, ACE I/D + b-fibrinogen -455 G/A, FV HR2 + b-fibrinogen -455 G/A showed a correlation as risk factors for Recurrent pregnancy loss. PMID: 28603947
  15. the signaling and anticoagulant functions of APC are in spatially and kinetically distinct compartments, and that it is possible to specifically inhibit the anticoagulant activity of APC. Targeting APC with a serpin is remarkably effective and may be safe for long-term prophylactic use in the treatment of hemophilia. PMID: 28632502
  16. Cleavage of FV at Arg(1545) , which abolishes the anticoagulant properties of FV and commits FV to the procoagulant pathway, is inhibited by binding of the TFPIalpha C-terminus to the FV acidic region PMID: 27801970
  17. The goal of this study was to evaluate the impact of EHR point-of-care tools on medical record documentation of genetic testing care processes for the common HFE mutations, a thrombophilia panel, and HLA-B27. PMID: 27362912
  18. Aside from a higher venous thromboembolism (VTE) prevalence and modestly reduced VTE-free survival, VTE penetrance and phenotype severity did not differ significantly among homozygous vs. heterozygous carriers. PMID: 26970916
  19. there is a synergistic effect of the FVL and rs4524 single nucleotide polymorphisms and active cancer on the risk of VTE. PMID: 27479824
  20. Our finding that the C2-domain of FVIII can be replaced by that of FV without compromising FVIII activity may have translational implications. PMID: 28057741
  21. These results demonstrate a new anticoagulant (cofactor) function of FV that targets the early phase of coagulation before prothrombinase assembly PMID: 28420729
  22. There was an increased odds of stillbirth for maternal homozygous factor V Leiden mutation. PMID: 27131585
  23. The Leiden mutation was significantly associated with recurrent pregnancy loss (p=0.017) PMID: 26564286
  24. The present meta-analysis suggests that V Leiden G1691A mutation is not significantly associated with increased risk of sudden sensorineural hearing loss in Italian population. PMID: 26620341
  25. Factor V Leiden was not associated with recurrent miscarriage during the first trimester of pregnancy in Brazilian women. PMID: 27525841
  26. Gene polymorphisms F5 C>G (rs6427196) were not associated with height, weight, or morbid obesity among European subjects. PMID: 27999448
  27. The carriage of mutant genotypes of FV 1691 G/A gene is a prognostic factor for rapid liver fibrosis progression in patients with Chronic hepatitis C. PMID: 27636933
  28. Our data demonstrated a significantly increased risk of hemodialysis vascular access thrombosis in carriers of the mutant FV (G1691A and A4070G) polymorphisms (P< 0.05) PMID: 27004938
  29. Desmopressin acetate has no effect on FV plasma concentration in patients with combined deficiency of factors V and VIII. PMID: 26599105
  30. F5 rs6025 and F11 rs2289252 contributed to the risk of recurrent venous thromboembolism and the combination is of potential clinical relevance for risk prediction PMID: 26423325
  31. Factor V (F5) c.1691G>A (Leiden) was present in 0.5% of 400 ischemic stroke patients in Sri Lanka. F5 mutation was present in a statistically significant number of patients with venous thrombosis (P = .005) compared to those with arterial thrombosis. PMID: 26522268
  32. FVL has a modifying effect on PAI-1 polymorphism in relation to risk of VTE recurrence. PMID: 26245493
  33. combination of FVL and MTHFR mutation related to the risk of recurrent fetal death and habitual abortion PMID: 25586317
  34. Case Report: acquired FV inhibitor that developed in a patient after exposure to human thrombin used as a hemostatic agent during an otorhinolaryngology surgical procedure. PMID: 26270511
  35. In the current study Factor V Leiden, prothrombin G20210A, and thrombospondin-1 polymorphisms showed no association with severity of hepatic fibrosis. PMID: 26768578
  36. Chromosomal abnormalities and abnormalities in the genes related to thrombophilia such as FVL, MTHFR and PTm mutations may be considered as risk factors for RM [recurrent miscarriage] PMID: 26060483
  37. Given the essential role of platelet-derived factor Va in clot formation, understanding the cellular and molecular mechanisms that regulate how platelets acquire this molecule will be important for the treatment of excessive bleeding or clotting PMID: 25800007
  38. F5 polymorphisms are not significant in the susceptibility to femoral head osteonecrosis in the Korean population. PMID: 26130054
  39. ). No significant difference was observed in the presence of FV 1691G/A and FII 20210G/A between any of the patients groups and the control group. PMID: 26261166
  40. the diagnosis of an 'unaffected' foetus was offered. The child was subsequently followed up after delivery and was found to be normal for factor V levels with a normal genotype PMID: 26261171
  41. Data (including data from case-control, genetic association studies) suggest that Factor V mutation Leiden is associated with significant genetic predisposition for venous thromboembolism (not thrombophilia) in pregnancy. [META-ANALYSIS, REVIEW] PMID: 26115054
  42. C2491T FV mutation associated with ischaemic stroke risk in Morocco, is reported. PMID: 26174681
  43. genetic association studies in population in Czech Republic: Data suggest point mutation in FV (Leiden) is associated with outcome in patients with hereditary thrombophilia/diabetes/limb ischemia following percutaneous transluminal angioplasty. PMID: 26247037
  44. FVL mutation is a significant determinant of coronary artery disease risk. PMID: 24360889
  45. Activated protein C has anti-inflammatory effects on human dendritic cells. PMID: 25891444
  46. Polymorphisms in factor V and antithrombin III gene in recurrent pregnancy loss PMID: 25771983
  47. presence of three novel variants in F5 gene in Chilean patients with activated protein C resistance; further studies are required to investigate the real contribution of these novel mutations to the APC resistance phenotype PMID: 25668227
  48. FV Leiden is a genetically determined and thus disease-independent parameter, which is associated with venous thromboembolism in cancer patients and could therefore be used for individual risk assignment. PMID: 25381723
  49. In mice, heterozygous FV Leiden carriers are protected from sepsis mortality after infection with clinically relevant human bacterial pathogens. PMID: 25690763
  50. Our study does not support the notion that factor V HR2 haplotype might be a risk factor for thrombosis despite its high prevalence among patients with PE. PMID: 26717220

Show More

Hide All

Involvement in disease
Factor V deficiency (FA5D); Thrombophilia due to activated protein C resistance (THPH2); Budd-Chiari syndrome (BDCHS); Ischemic stroke (ISCHSTR); Pregnancy loss, recurrent, 1 (RPRGL1)
Subcellular Location
Secreted.
Protein Families
Multicopper oxidase family
Tissue Specificity
Plasma.
Database Links

HGNC: 3542

OMIM: 188055

KEGG: hsa:2153

STRING: 9606.ENSP00000356771

UniGene: Hs.30054

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*