Recombinant Human Coagulation factor V(F5),partial

Code CSB-EP007929HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP007929HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) F5.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP007929HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) F5.
The Latest Promotion
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names F5
Uniprot No. P12259
Research Area Cardiovascular
Alternative Names Activated protein C cofactor; APC cofactor; coagulation factor V (proaccelerin; labile factor); Coagulation factor V; coagulation factor V jinjiang A2 domain; Coagulation factor V light chain; F5; FA5_HUMAN; Factor V Leiden; FactorV; FVL; Labile factor; PCCF; Proaccelerin; proaccelerin; labile factor; Protein C cofactor; RPRGL1; THPH2
Species Homo sapiens (Human)
Source E.coli
Expression Region 1490-1614aa
Target Protein Sequence MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTT
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 30.4kDa
Protein Length Partial
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Central regulator of hemostasis. It serves as a critical cofactor for the prothrombinase activity of factor Xa that results in the activation of prothrombin to thrombin.
Gene References into Functions
  1. factor V Leiden and MTHFR C677T polymorphisms were significantly associated with recurrent pregnancy loss (RPL) in Bosnian women... PMID: 29703881
  2. study found the FVL A allele frequency and GA genotype are significantly more prevalent among patients with coronary artery disease (CAD) compared to controls and may be predisposing to CAD; further found that the FVL mutation is an independent risk factor whose effect is not modified by other risk factors; FV HR2 variation does not show any statistically significant association with CAD PMID: 29179580
  3. suggesting that the FVL paradox is related to the carriership of one wild type and one mutated factor V allele PMID: 29320959
  4. Review/Meta-analysis: Factor V G1691A single nucleotide gene polymorphism was associated with risk of ischemic stroke mainly in young adults. PMID: 29478939
  5. Factor V Leiden mutation is associated with venous thromboembolism in cancer. PMID: 29775482
  6. Human FVL carriers have a higher total sperm count than non-carriers, with an adjusted mean difference of 31 x 106 (95%CI 0.2-61.7; P = 0.048). PMID: 28927238
  7. contribution of FVLeiden causing resistance to activated protein C in Indian population is not as strong as previously reported in Western countries PMID: 26699866
  8. The frequencies of GA and AA genotypes and A allele of coagulation factor V (FV) 1691G>A polymorphism significantly increased in the lower extremity deep venous thrombosis (LDVT) group. Patients with LDVT carrying A allele (GA + AA) had both higher patency and recurrence rates than those carrying GG genotype. Coagulation factor V (FV) 1691G>A polymorphism may be associated with both the risk and prognosis of LDVT. PMID: 29851809
  9. Factor V Leiden-mutations were found in 16.8% of patients with cerebral sinus venous thrombosis and in 17.8% of patients with arterial ischemic stroke, which was significantly more frequent than in controls at a rate of 4.95% (ORs: 3.89 and 4.16). PMID: 28869458
  10. Double heterozygotes had a clinical presentation intermediate between FVL and prothrombin mutation single carriers. PMID: 28577389
  11. genetic study of Factor V Leiden (G1691A) mutation in young ischemic strokes with large vessel disease in a South Indian population PMID: 28711293
  12. results suggest that some SNPs of F5 and a high or low FV:C level might be associated with recurrent miscarriage PMID: 27655299
  13. FVBonn induces hypercoagulability via a combination of increased activation/procoagulant activity, decreased susceptibility to Activated protein C-mediated inactivation, and slightly reduced APC cofactor activity PMID: 27090446
  14. Heterozygous FV Leiden, homozygous PAI-1 4G/4G, heterozygous MTHFR C677T, homozygous MTHFR A1298C, as much as the combined thrombophilic genotypes MTHFR 677T + ACE Iota/D, MTHFR 677T/1298C + ACE D/D, ACE I/D + b-fibrinogen -455 G/A, FV HR2 + b-fibrinogen -455 G/A showed a correlation as risk factors for Recurrent pregnancy loss. PMID: 28603947
  15. the signaling and anticoagulant functions of APC are in spatially and kinetically distinct compartments, and that it is possible to specifically inhibit the anticoagulant activity of APC. Targeting APC with a serpin is remarkably effective and may be safe for long-term prophylactic use in the treatment of hemophilia. PMID: 28632502
  16. Cleavage of FV at Arg(1545) , which abolishes the anticoagulant properties of FV and commits FV to the procoagulant pathway, is inhibited by binding of the TFPIalpha C-terminus to the FV acidic region PMID: 27801970
  17. The goal of this study was to evaluate the impact of EHR point-of-care tools on medical record documentation of genetic testing care processes for the common HFE mutations, a thrombophilia panel, and HLA-B27. PMID: 27362912
  18. Aside from a higher venous thromboembolism (VTE) prevalence and modestly reduced VTE-free survival, VTE penetrance and phenotype severity did not differ significantly among homozygous vs. heterozygous carriers. PMID: 26970916
  19. there is a synergistic effect of the FVL and rs4524 single nucleotide polymorphisms and active cancer on the risk of VTE. PMID: 27479824
  20. Our finding that the C2-domain of FVIII can be replaced by that of FV without compromising FVIII activity may have translational implications. PMID: 28057741
  21. These results demonstrate a new anticoagulant (cofactor) function of FV that targets the early phase of coagulation before prothrombinase assembly PMID: 28420729
  22. There was an increased odds of stillbirth for maternal homozygous factor V Leiden mutation. PMID: 27131585
  23. The Leiden mutation was significantly associated with recurrent pregnancy loss (p=0.017) PMID: 26564286
  24. The present meta-analysis suggests that V Leiden G1691A mutation is not significantly associated with increased risk of sudden sensorineural hearing loss in Italian population. PMID: 26620341
  25. Factor V Leiden was not associated with recurrent miscarriage during the first trimester of pregnancy in Brazilian women. PMID: 27525841
  26. Gene polymorphisms F5 C>G (rs6427196) were not associated with height, weight, or morbid obesity among European subjects. PMID: 27999448
  27. The carriage of mutant genotypes of FV 1691 G/A gene is a prognostic factor for rapid liver fibrosis progression in patients with Chronic hepatitis C. PMID: 27636933
  28. Our data demonstrated a significantly increased risk of hemodialysis vascular access thrombosis in carriers of the mutant FV (G1691A and A4070G) polymorphisms (P< 0.05) PMID: 27004938
  29. Desmopressin acetate has no effect on FV plasma concentration in patients with combined deficiency of factors V and VIII. PMID: 26599105
  30. F5 rs6025 and F11 rs2289252 contributed to the risk of recurrent venous thromboembolism and the combination is of potential clinical relevance for risk prediction PMID: 26423325
  31. Factor V (F5) c.1691G>A (Leiden) was present in 0.5% of 400 ischemic stroke patients in Sri Lanka. F5 mutation was present in a statistically significant number of patients with venous thrombosis (P = .005) compared to those with arterial thrombosis. PMID: 26522268
  32. FVL has a modifying effect on PAI-1 polymorphism in relation to risk of VTE recurrence. PMID: 26245493
  33. combination of FVL and MTHFR mutation related to the risk of recurrent fetal death and habitual abortion PMID: 25586317
  34. Case Report: acquired FV inhibitor that developed in a patient after exposure to human thrombin used as a hemostatic agent during an otorhinolaryngology surgical procedure. PMID: 26270511
  35. In the current study Factor V Leiden, prothrombin G20210A, and thrombospondin-1 polymorphisms showed no association with severity of hepatic fibrosis. PMID: 26768578
  36. Chromosomal abnormalities and abnormalities in the genes related to thrombophilia such as FVL, MTHFR and PTm mutations may be considered as risk factors for RM [recurrent miscarriage] PMID: 26060483
  37. Given the essential role of platelet-derived factor Va in clot formation, understanding the cellular and molecular mechanisms that regulate how platelets acquire this molecule will be important for the treatment of excessive bleeding or clotting PMID: 25800007
  38. F5 polymorphisms are not significant in the susceptibility to femoral head osteonecrosis in the Korean population. PMID: 26130054
  39. ). No significant difference was observed in the presence of FV 1691G/A and FII 20210G/A between any of the patients groups and the control group. PMID: 26261166
  40. the diagnosis of an 'unaffected' foetus was offered. The child was subsequently followed up after delivery and was found to be normal for factor V levels with a normal genotype PMID: 26261171
  41. Data (including data from case-control, genetic association studies) suggest that Factor V mutation Leiden is associated with significant genetic predisposition for venous thromboembolism (not thrombophilia) in pregnancy. [META-ANALYSIS, REVIEW] PMID: 26115054
  42. C2491T FV mutation associated with ischaemic stroke risk in Morocco, is reported. PMID: 26174681
  43. genetic association studies in population in Czech Republic: Data suggest point mutation in FV (Leiden) is associated with outcome in patients with hereditary thrombophilia/diabetes/limb ischemia following percutaneous transluminal angioplasty. PMID: 26247037
  44. FVL mutation is a significant determinant of coronary artery disease risk. PMID: 24360889
  45. Activated protein C has anti-inflammatory effects on human dendritic cells. PMID: 25891444
  46. Polymorphisms in factor V and antithrombin III gene in recurrent pregnancy loss PMID: 25771983
  47. presence of three novel variants in F5 gene in Chilean patients with activated protein C resistance; further studies are required to investigate the real contribution of these novel mutations to the APC resistance phenotype PMID: 25668227
  48. FV Leiden is a genetically determined and thus disease-independent parameter, which is associated with venous thromboembolism in cancer patients and could therefore be used for individual risk assignment. PMID: 25381723
  49. In mice, heterozygous FV Leiden carriers are protected from sepsis mortality after infection with clinically relevant human bacterial pathogens. PMID: 25690763
  50. Our study does not support the notion that factor V HR2 haplotype might be a risk factor for thrombosis despite its high prevalence among patients with PE. PMID: 26717220
  51. This meta-analysis suggested that FVL was not a risk factor for sepsis and sepsis mortality PMID: 23804230
  52. The Prevalence of Factor V Leiden (G1691A) and Methylenetetrahydrofolate Reductase C677T Mutations in Sickle Cell Disease in Western India. PMID: 23869056
  53. Polyphosphate greatly accelerates factor V activation by factor XIa, and that this is supported by polyphosphate polymers of the size secreted by activated human platelets. PMID: 25338662
  54. This study failed to demonstrate any association between factor V Leiden polymorphism or prothrombin variant with sudden sensorineural hearing loss. PMID: 25538030
  55. Factor V gene is a risk factor in the development of venous thromboembolism. PMID: 25341889
  56. Report the application of a reconstruction protocol, named AFM-assembly, to characterise the conformational variability of the two C domains of human coagulation factor Va. PMID: 25185589
  57. FVL [factor V Leiden]polymorphisms between EOPE [ early-onset preeclampsia] and LOPE [ late-onset preeclampsia]/controls were observed PMID: 25480409
  58. A statistically significant higher frequency of factor V Leiden polymorphism was observed in the Slovak majority patient group compared to the control group. This polymorphism was not associated with complications in the Roma group. PMID: 25549181
  59. FVL mutation was associated with tamoxifen-associated venous thromboembolism in breast cancer patients. PMID: 25592075
  60. Factor V Leiden carrier state may increase the susceptibility for early recurrent pregnancy loss. PMID: 25193429
  61. Increased coagulation activity and genetic polymorphisms in the F5, F10 and EPCR genes are associated with breast cancer. PMID: 25407022
  62. Based on a meta-analysis, the F5 mutation is associated with an increased risk of Budd-Chiari syndrome, portal vein thrombosis without cirrhosis, and portal vein thrombosis in cirrhosis. PMID: 24793031
  63. Found a novel gain-of-function mutation in the F5 gene (c.C2588G), which leads to an aberrant splicing of F5 and ultimately to a short factor V protein (missing 623 amino acids from the B domain), which we called factor V Amsterdam. PMID: 25634741
  64. Arg306 mutations in factor V gene were involved in the ischemic stroke in two unrelated young men. PMID: 25360683
  65. Factor V Leiden was associated with a 1.5-fold increased 5-year all-cause mortality risk in dialysis patients. PMID: 24816905
  66. Data suggest factor Xa (FXa) and factor Va (FVa) compete to bind FXa on both PS model membranes and microparticles from activated platelets; this competition between dimerization/prothrombinase complex formation appears to regulate blood coagulation. PMID: 25572019
  67. Blood coagulation and fibrinolysis are more activated in women with the Factor V Leiden mutation than in non-carriers during pregnancy and early postpartum. PMID: 25135795
  68. Single nucleotide polymorphisms other than factor V Leiden are associated with coagulopathy and osteonecrosis of the femoral head in Chinese patients. PMID: 25119470
  69. The C V coagulation factor and recurrent miscarriages PMID: 25775875
  70. a synthetic peptide mimicking the C-terminus of the fibrinogen gamma' chain, which binds thrombin and inhibits its activities, greatly increased the APC sensitivity of normal and FV Leiden plasma PMID: 24951429
  71. This is the first report of a genomic interaction between a thrombophilia marker and oral anticoagulation in patients coinheriting a sensitive warfarin metabolizing genotype and a thrombophilia marker like FVL mutation. PMID: 24630642
  72. polymorphism associated with recurrent miscarriage PMID: 24484533
  73. distribution of INR was influenced by variants in CYP4F2 rs2108622, CYP2C9*3, rs9332230, VKORC1 1173C>T, -1639G>A, rs55894764, ABCB1 rs2032582, rs1128503, rs1045642 and F5 rs6025, age, smoking and concomitant drugs PMID: 24911077
  74. Thrombophilic genotypes such as factor V Leiden increase risk of venous thromboembolism in users of combined hormonal contraception. PMID: 25162263
  75. Asp68His mutation may result in intracellular defective trafficking and enhanced degradation, and impaired secretion of FV protein PMID: 24893683
  76. Mutation analyses were conducted using the real-time polymerase chain reaction method to screen six common mutations (Factor V G1691A, PT G20210A, Factor XIII V34L, MTHFR A1298C and C677T and PAI-1 -675 4G/5G) found in CVD panel PMID: 24532105
  77. Although platelet fVa shows slightly superior resistance to aPC's effects compared to plasma fVa, neither fVa is sufficiently cleaved in simulations of acute traumatic coagulopathy or pharmacologically-delivered aPC to diminish coagulation parameters. PMID: 24921658
  78. paternal carriage of FV Leiden may have a role in predisposition to recurrent pregnancy loss PMID: 24977289
  79. TFPI-2 in platelets from normal or pregnant subjects and in plasma from pregnant women binds FV/Va and regulates intrinsic coagulation and fibrinolysis PMID: 25262870
  80. Subgroup analyses suggested that FVL was associated with an increased risk of BCS in the population with high background mutation prevalence. PMID: 24755609
  81. MTHFR C677T and FVL G1691A polymorphisms may be risk factors for increased vascular complications in patient with sickle cell disease. PMID: 23992124
  82. Lifelong anticoagulation may benefit individuals heterozygous for factor V Leiden and previous idiopathic venous thromboembolism. PMID: 24112753
  83. Stud shows that R2 polymorphism could be inherited in cis position with FVL and also the family members could have co-inheritance of the FVL and R2 on the same chromosome as proband. PMID: 22589460
  84. findings show the thrombophilic factor V Leiden (FVL) mutation is commonly associated with and may be pathoetiologic for hip osteonecrosis PMID: 22696591
  85. Combined germline variations in FV Leiden and Apo E4 genes were associated with genesis of lung cancer PMID: 24175756
  86. Replication and meta-analysis support an increased risk of preterm birth in Caucasians with the fetal FVL mutation. PMID: 23835654
  87. Factor Va has regulatory effects on factor Xa and its structure. PMID: 24467409
  88. It is demonstrated that proposed approach is a simple in its application, effective and relatively inexpensive technique of detection of Leiden one-nucleotide polymorphism in gene V of blood coagulation factor. PMID: 24757862
  89. A systematic review and meta-analysis suggest that patients with Factor V Leiden are significantly more likely to present with proximal than distal deep venous thrombosis. PMID: 23615845
  90. APC resistance due to Factor V Leiden is not related to baseline inflammatory mediators or survival up to 10 years in patients with critical limb ischemia PMID: 23212804
  91. factor V Leiden homozygous carriers are at risk for thromboembolism and placenta-related complications during pregnancy PMID: 24645228
  92. implicate protein S residues 37-50 as a binding site for FVa that mediates, at least in part, the direct inhibition of FVa-dependent procoagulant activity by protein S PMID: 23892573
  93. Abnormal Doppler velocimetry measurements in the umbilical artery are associated with fetal factor V Leiden (FVL) carriership and fetoplacental pathology (fetoplacental thrombotic vasculopathy and ischemic lesions). PMID: 23544862
  94. Studies indicate that congenital coagulation factor V (FV) deficiency is a rare bleeding disorder caused by mutations in FV gene that almost exclusively lowers plasma FV levels. PMID: 23893775
  95. Studies indicate that the LMAN1-CRD contains distinct, separable binding sites for both its partner protein MCFD2 and the cargo proteins FV/FVIII. PMID: 23852824
  96. Our results suggest that there may be an association between increased risk for RVO and ACE I/D, MTHFR C677T, PAI-1 4G/5G and factor V Leiden polymorphisms, whereas the Val34Leu variant may exert a protective effect. PMID: 23289804
  97. These data indicate the essential role of factor V R1698 for normal biosynthetic process and support local flexibility for positively or negatively charged residues to produce stable and functional A3-A2 domain interactions. PMID: 23616041
  98. study suggested that the FVL mutation may be a risk factor for hepatic artery thrombosis in liver transplantation PMID: 23769091
  99. amino acid region 1000-1008 of fV is a regulatory sequence protecting the organisms from spontaneous binding to fXa and unnecessary prothrombinase complex formation, which in turn results in catastrophic physiological consequences. PMID: 24178294
  100. The factor V Leiden mutation is significantly related to Perthes disease. PMID: 23983171

Show More

Hide All

Involvement in disease Factor V deficiency (FA5D); Thrombophilia due to activated protein C resistance (THPH2); Budd-Chiari syndrome (BDCHS); Ischemic stroke (ISCHSTR); Pregnancy loss, recurrent, 1 (RPRGL1)
Subcellular Location Secreted
Protein Families Multicopper oxidase family
Tissue Specificity Plasma.
Database Links

HGNC: 3542

OMIM: 188055

KEGG: hsa:2153

STRING: 9606.ENSP00000356771

UniGene: Hs.30054

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1