Recombinant Human GTPase KRas(KRAS),partial

Code CSB-EP012493HU1
Product Type Recombinant Protein
Size $1726
Uniprot No. P01116
Relevance Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation .Curated2 Publications
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Alias K-Ras 2Ki-Rasc-K-rasc-Ki-ras
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRL
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names KRAS
Expression Region 2-168aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 23.1kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation
Involvement in disease Leukemia, acute myelogenous (AML); Leukemia, juvenile myelomonocytic (JMML); Noonan syndrome 3 (NS3); Gastric cancer (GASC); Cardiofaciocutaneous syndrome 2 (CFC2)
Subcellular Location Cell membrane, Lipid-anchor, Cytoplasmic side, Cytoplasm, cytosol
Protein Families Small GTPase superfamily, Ras family
Database Links

HGNC: 6407

OMIM: 190070

KEGG: hsa:3845

STRING: 9606.ENSP00000256078

UniGene: Hs.37003

Pathway Chemokine signaling pathway
ErbB signaling pathway
Estrogen signaling pathway
MAPK signaling pathway
Melanogenesis
mTOR signaling pathway
PI3K-Akt signaling pathway
VEGF signaling pathway
Gap junction
Regulation of actin cytoskeleton
Apoptosis
Autophagy
Cellular senescence
Ras signaling pathway
Signaling pathways regulating pluripotency of stem cells
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Apelin signaling pathway
FoxO signaling pathway
Insulin signaling pathway
Phospholipase D signaling pathway
Rap1 signaling pathway
Sphingolipid signaling pathway
Neurotrophin signaling pathway

Related Products

KRAS Antibodies

KRAS Antibodies for Homo sapiens (Human)

KRAS Antibodies for Human

KRAS Proteins

KRAS Proteins for Homo sapiens (Human)

KRAS ELISA Kit

KRAS ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.