Your Good Partner in Biology Research

Tel : 301-363-4651

Recombinant Human GTPase KRas(KRAS),partial

Code	CSB-EP012493HU1
Product Type	Recombinant Protein
Size	$1726
Uniprot No.	P01116
Relevance	Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation .Curated2 Publications
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer	Tris-based buffer,50% glycerol
Alias	K-Ras 2Ki-Rasc-K-rasc-Ki-ras
Species	Homo sapiens (Human)
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRL
Research Area	Epigenetics and Nuclear Signaling
Source	E.coli
Gene Names	KRAS
Expression Region	2-168aa
Tag Info	N-terminal 6xHis-tagged
Mol. Weight	23.1kDa
Protein Description	Partial
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions?	Leave a Message or Start an on-line Chat

Function	Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation
Involvement in disease	Leukemia, acute myelogenous (AML); Leukemia, juvenile myelomonocytic (JMML); Noonan syndrome 3 (NS3); Gastric cancer (GASC); Cardiofaciocutaneous syndrome 2 (CFC2)
Subcellular Location	Cell membrane, Lipid-anchor, Cytoplasmic side, Cytoplasm, cytosol
Protein Families	Small GTPase superfamily, Ras family
Database Links	HGNC: 6407 OMIM: 190070 KEGG: hsa:3845 STRING: 9606.ENSP00000256078 UniGene: Hs.37003
Pathway	Chemokine signaling pathway ErbB signaling pathway Estrogen signaling pathway MAPK signaling pathway Melanogenesis mTOR signaling pathway PI3K-Akt signaling pathway VEGF signaling pathway Gap junction Regulation of actin cytoskeleton Apoptosis Autophagy Cellular senescence Ras signaling pathway Signaling pathways regulating pluripotency of stem cells B cell receptor signaling pathway Fc epsilon RI signaling pathway Natural killer cell mediated cytotoxicity T cell receptor signaling pathway AGE-RAGE signaling pathway in diabetic complications Apelin signaling pathway FoxO signaling pathway Insulin signaling pathway Phospholipase D signaling pathway Rap1 signaling pathway Sphingolipid signaling pathway Neurotrophin signaling pathway

Related Products

KRAS Antibodies for Homo sapiens (Human)

Code	Product Name	Species Reactivity	Application
CSB-PA13969C0Rb	KRAS Antibody, FITC conjugated	Human	ELISA
CSB-PA13969B0Rb	KRAS Antibody, HRP conjugated	Human	ELISA
CSB-PA012493GA01HU	KRAS Antibody	Human,Mouse,Rat	ELISA,WB,IHC
CSB-PA13969D0Rb	KRAS Antibody, Biotin conjugated	Human	ELISA
CSB-PA13967B0Rb	KRAS Antibody, HRP conjugated	Human	ELISA
CSB-PA13967C0Rb	KRAS Antibody, FITC conjugated	Human	ELISA
CSB-PA13967D0Rb	KRAS Antibody, Biotin conjugated	Human	ELISA

KRAS Antibodies for Human

Code	Product Name	Species Reactivity	Application
CSB-PA13969A0Rb	KRAS Antibody	Human, Mouse	ELISA, WB, IHC, IF
CSB-PA13967A0Rb	KRAS Antibody	Human	ELISA, IHC, IF

KRAS Proteins for Homo sapiens (Human)

Code	Product Name	Source
CSB-YP012493HU CSB-EP012493HU CSB-BP012493HU CSB-MP012493HU	Recombinant Human GTPase KRas(KRAS)	Yeast E.coli Baculovirus Mammalian cell
CSB-EP012493HU1	Recombinant Human GTPase KRas(KRAS),partial	E.coli

KRAS ELISA Kit for Homo sapiens (Human)

Code	Product Name	Sample Types	Sensitivity
CSB-EL012493HU	Human GTPase KRas(KRAS) ELISA kit	serum, plasma, tissue homogenates	5.8 pg/mL

Recombinant Human Reelin(RELN),partial

Express system: E.coli

Species: Homo sapiens (Human)
Recombinant Human Eukaryotic translation initiation factor 4 gamma 1(EIF4G1),partial

Express system: E.coli

Species: Homo sapiens (Human)
Recombinant Human N-acetylgalactosamine-6-sulfatase(GALNS)

Express system: Yeast

Species: Homo sapiens (Human)
Recombinant Human Probable global transcription activator SNF2L2(SMARCA2),partial

Express system: E.coli

Species: Homo sapiens (Human)
Recombinant Human Tryptophan 2,3-dioxygenase(TDO2)

Express system: E.coli

Species: Homo sapiens (Human)
Recombinant Rat Carboxypeptidase A1(Cpa1)

Express system: E.coli

Species: Rattus norvegicus (Rat)
Recombinant Mouse Immunoglobulin J chain(Jchain)

Express system: E.coli

Species: Mus musculus (Mouse)
Recombinant Sheep Somatoliberin(GHRH)

Express system: E.coli

Species: Ovis aries (Sheep)

Product Center

Promotions

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

We don't deal in spam.

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How did you know this promotion?

Email

Distributor

Search engine

Advertisement

Others
Check Code：