Code | CSB-EP012493HU1 |
Size | $1812 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
The Human KRAS recombinant protein is conventionally generated by transfecting the recombinant DNA into a host cell, and then the host cells are cultured and the transfected DNA transcribed and translated. Different host cells can be chosen for recombinant protein production, the choice of which depends on the type of protein that needs to be generated, its functional activity and requisite yield. We choose E.coli as the expression system for this KRAS protein expression because bacteria cells are easy to culture, grow fast and produce high yields of recombinant protein. KRAS is a protein coding gene that encodes GTPase KRas. According to some research, KRAS may have the following features.KRAS mutation status predicts colorectal cancer response to cetuximab therapy. KRAS proteins play an important role in human cancers but have not yet succumbed to therapeutic attack. By determining the mutational status of EGFR and KRAS, treatment decisions regarding the use of these kinase inhibitors may be improved. GTPase KRAS inhibits the p53 tumor suppressor by activating the NRF2-regulated antioxidant defense system in cancer cells. The quantitative biophysical analysis identified key components that regulate the recruitment of the GTPase KRAS to the plasma membrane. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | KRAS |
Uniprot No. | P01116 |
Research Area | Epigenetics and Nuclear Signaling |
Alternative Names |
c Ki ras2; c Kirsten ras protein; c-K-ras; c-Ki-ras; Cellular c Ki ras2 proto oncogene; Cellular transforming proto oncogene; CFC2; cK Ras; GTPase KRas; K RAS p21 protein; K RAS2A; K RAS2B; K RAS4A; K RAS4B; K-Ras 2; KI RAS; Ki-Ras; KIRSTEN MURINE SARCOMA VIRUS 2; Kirsten rat sarcoma 2 viral (v Ki ras2) oncogene homolog; Kirsten rat sarcoma viral oncogene homolog; KRAS; KRAS proto oncogene, GTPase; KRAS1; KRAS2; N-terminally processed; NS; NS3; Oncogene KRAS2; p21ras; PR310 c K ras oncogene; PR310 cK ras oncogene; RALD; RASK_HUMAN; RASK2; Transforming protein p21; v Ki ras2 Kirsten rat sarcoma 2 viral oncogene homolog; v Ki ras2 Kirsten rat sarcoma viral oncogene homolog
|
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 2-168aa |
Target Protein Sequence | TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 23.1kDa |
Protein Length | Partial |
Tag Info |
N-terminal 6xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation. Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner.
|
Gene References into Functions |
|
Involvement in disease | Leukemia, acute myelogenous (AML); Leukemia, juvenile myelomonocytic (JMML); Noonan syndrome 3 (NS3); Gastric cancer (GASC); Cardiofaciocutaneous syndrome 2 (CFC2) |
Subcellular Location | Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm, cytosol.; [Isoform 2B]: Cell membrane; Lipid-anchor. |
Protein Families | Small GTPase superfamily, Ras family |
Database Links |
HGNC: 6407 OMIM: 190070 KEGG: hsa:3845 STRING: 9606.ENSP00000256078 UniGene: Hs.37003 |