Recombinant Human Mitogen-activated protein kinase 13 (MAPK13)

Code CSB-EP013452HU
Abbreviation Recombinant Human MAPK13 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
MAP kinase 13; MAP kinase p38 delta; MAPK 13; MAPK-13; Mapk13; MGC99536; Mitogen activated protein kinase 13; Mitogen-activated protein kinase 13; Mitogen-activated protein kinase p38 delta; MK13_HUMAN; OTTHUMP00000016282; OTTHUMP00000016283; p38 delta; P38delta; PRKM13; SAPK 4 ; SAPK4; Stress activated protein kinase 4; Stress-activated protein kinase 4
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-365aa
Target Protein Sequence
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
58.1kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK13 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors such as ELK1 and ATF2. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each. MAPK13 is one of the less studied p38 MAPK isoforms. Some of the targets are downstream kinases such as MAPKAPK2, which are activated through phosphorylation and further phosphorylate additional targets. Plays a role in the regulation of protein translation by phosphorylating and inactivating EEF2K. Involved in cytoskeletal remodeling through phosphorylation of MAPT and STMN1. Mediates UV irradiation induced up-regulation of the gene expression of CXCL14. Plays an important role in the regulation of epidermal keratinocyte differentiation, apoptosis and skin tumor development. Phosphorylates the transcriptional activator MYB in response to stress which leads to rapid MYB degradation via a proteasome-dependent pathway. MAPK13 also phosphorylates and down-regulates PRKD1 during regulation of insulin secretion in pancreatic beta cells.
Gene References into Functions
  1. The knockdown of MAPK13 also blocked the effect of miR23a5p in osteogenic differentiation of bone marrow-derived mesenchymal stem cells. PMID: 29344643
  2. expression of claudin-11 in cutaneous squamous cell carcinoma cells depended on the activity of p38delta MAPK PMID: 27992079
  3. Study proposes MAPK p38delta protein as a key factor in breast cancer. PMID: 28783172
  4. The p38delta mitogen-activated protein kinase was identified as a novel regulator of NLRP3 inflammasome activation in primary human macrophages, and thus, represents a potential target for modulation of atherosclerotic inflammation. PMID: 27417584
  5. p38delta expression was significantly higher in esophageal squamous cell carcinoma tissues compared with paired normal controls. No significant association was found for p38delta between its expression and other clinicopathological parameters. In Eca109 cells, p38delta can promote the cell growth and motility. p38delta overexpression promotes tumorigenesis in nude mice when p38delta was stably over-expressed and p38ga... PMID: 26666822
  6. MAPK13 gene knockdown using siRNA reduced the aldehyde dehydrogenase high cell population and abrogated the tumor-initiating ability. PMID: 26969274
  7. p38gamma and p38delta reprogram liver metabolism by modulating neutrophil infiltration and provide a potential target for NAFLD therapy PMID: 26843485
  8. MAPK13 undergoes a larger interlobe configurational rearrangement upon activation compared with MAPK14. PMID: 25849390
  9. PKCdelta activates a MEKK1/MEK3/p38delta MAPK cascade to increase p53 levels and p53 drives p21(Cip1) gene expression. PMID: 24599959
  10. esophageal squamous cell carcinoma cell lines which are p38delta-negative grew more quickly than cell lines which express endogenous p38delta. PMID: 23722928
  11. DNA methylation alterations are widespread in melanoma; epigenetic silencing of MAPK13 contributes to melanoma progression PMID: 23590314
  12. Data indicate that p38delta mediates oncogene-induced senescence through a p53- and p16(INK4A)-independent mechanism. PMID: 23878395
  13. GSK3alpha, GSK3beta, and MAPK13 were found to be the most active tau kinases, phosphorylating tau at all four epitopes. PMID: 23798682
  14. MAPK13 is responsible for IL-13-driven mucus production in human airway epithelial cells. PMID: 23187130
  15. Isoforms of p38MAPK gamma and delta contribute to differentiation of human AML cells induced by 1,25-dihydroxyvitamin D. PMID: 20804750
  16. Taken together, the data indicate that the respective stress-dependent action of p38 isoforms is responsible for the up-regulation of the gene expression of the chemokine BRAK/CXCL14. PMID: 20478268
  17. Function of p38delta in regulating of epidermal keratinocyte differentiation, apoptosis and skin tumor development, is discussed. PMID: 20090411
  18. results indicate that p38delta is important for motility and invasion of CC cells, suggesting that p38delta may play an important role in CC metastasis. PMID: 19816939
  19. Novel protein kinase C isoforms regulate human keratinocyte differentiation by activating a p38 delta mitogen-activated protein kinase cascade that targets CCAAT/enhancer-binding protein alpha PMID: 12080077
  20. p38 has a role in mediating induction of VEGF mRNA expression by sodium arsenite PMID: 12482858
  21. observations suggest that p38 delta is the major p38 isoform driving suprabasal hINV gene expression and that p38 delta directly regulates ERK1/2 activity via formation of a p38 delta-ERK1/2 complex PMID: 12810719
  22. sapk4 activation mediates apoptosis and neurodegeneration in infantile neuronal ceroid lipofuscinosis PMID: 16644870
  23. activation of p38 isoforms by hypertonicity does not contribute to activation of TonEBP/OREBP because of opposing effects of p38alpha and p38delta. PMID: 18367666
  24. These results suggest that, in SupT1-based cell lines, p38alpha, p38gamma and p38delta, but not p38beta, are implicated in both HIV-1 induced replication and apoptosis in infected and uninfected bystander cells. PMID: 18559936

Show More

Hide All

Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, MAP kinase subfamily
Tissue Specificity
Expressed in testes, pancreas, small intestine, lung and kidney. Abundant in macrophages, also present in neutrophils, CD4+ T-cells, and endothelial cells.
Database Links

HGNC: 6875

OMIM: 602899

KEGG: hsa:5603

STRING: 9606.ENSP00000211287

UniGene: Hs.178695

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*