Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-EP002611MO |
| Size | US$2466 |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
In the production of recombinant Mouse Bcl2 protein, the gene for Bcl2 (E.coli) was cloned into a vector and expressed as Bcl2 protein in E.coli. The plasmids with the copy of Bcl2, or the expression vector, were often used to enhance gene expression. Every step of production was undergone with a strict QC system. N-terminal 6xHis tag was used in the process. The purity is 90% determined by SDS-PAGE. Bcl-2 was the first identified cellular protein that functions as an oncogene by blocking apoptotic cell death. Bcl-2 was initially cloned from the breakpoint of the t(14:18) chromosomal translocation found in the majority of patients with follicular lymphoma. Its oncogenic activity was established when transgenic mice bearing a BCL-2 immunoglobulin minigene fusion that recapitulates the t(14:18) translocation were found to develop follicular hyperplasia and lymphoma.For almost two decades, Bcl-2 has been thought to act by inhibiting one specific form of programmed cell death, apoptosis. Nearly all of the effects of Bcl-2 in cancer have been attributed to its effects on the apoptotic pathway, although it is known that Bcl-2 family members are multifunctional proteins that can influence other cellular processes, including cell cycle progression, calcineurin signaling, glucose homeostasis, and transcriptional repression by p53. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | Bcl2 |
| Uniprot No. | P10417 |
| Research Area | Others |
| Alternative Names |
Bcl2; Bcl-2; Apoptosis regulator Bcl-2
|
| Species | Mus musculus (Mouse) |
| Source | E.coli |
| Expression Region | 5-205aa |
| Target Protein Sequence | GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 26.7kDa |
| Protein Length | Partial |
| Tag Info |
N-terminal 6xHis-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function. May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release.
|
| Gene References into Functions |
|
| Subcellular Location | Mitochondrion outer membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein. |
| Protein Families | Bcl-2 family |
| Tissue Specificity | Expressed in a variety of tissues. |
| Database Links |
KEGG: mmu:12043 STRING: 10090.ENSMUSP00000108371 UniGene: Mm.257460 |
