Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Bcl2; Bcl-2; Apoptosis regulator Bcl-2
Species
Mus musculus (Mouse)
Expression Region
5-205aa
Target Protein Sequence
GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
In the production of recombinant Mouse Bcl2 protein, the gene for Bcl2 (E.coli) was cloned into a vector and expressed as Bcl2 protein in E.coli. The plasmids with the copy of Bcl2, or the expression vector, were often used to enhance gene expression. Every step of production was undergone with a strict QC system. N-terminal 6xHis tag was used in the process. The purity is 90% determined by SDS-PAGE.
Bcl-2 was the first identified cellular protein that functions as an oncogene by blocking apoptotic cell death. Bcl-2 was initially cloned from the breakpoint of the t(14:18) chromosomal translocation found in the majority of patients with follicular lymphoma. Its oncogenic activity was established when transgenic mice bearing a BCL-2 immunoglobulin minigene fusion that recapitulates the t(14:18) translocation were found to develop follicular hyperplasia and lymphoma.For almost two decades, Bcl-2 has been thought to act by inhibiting one specific form of programmed cell death, apoptosis. Nearly all of the effects of Bcl-2 in cancer have been attributed to its effects on the apoptotic pathway, although it is known that Bcl-2 family members are multifunctional proteins that can influence other cellular processes, including cell cycle progression, calcineurin signaling, glucose homeostasis, and transcriptional repression by p53.