Recombinant Mouse Protein c-Fos (Fos)

Code CSB-EP008790MO
Abbreviation Recombinant Mouse Fos protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-380aa
Target Protein Sequence
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANFIPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTQSAGAYARAGMVKTVSGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEASTPESEEAFTLPLLNDPEPKPSLEPVKSISNVELKAEPFDDFLFPASSRPSGSETSRSVPDVDLSGSFYAADWEPLHSNSLGMGPMVTELEPLCTPVVTCTPGCTTYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.8 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Binding of DHA to c-Fos analyzed by biolayer interferometry

Review: The binding of DHA to immobilized recombinant c-Fos at 50 ng/mL was determined by biolayer interferometry. Blank probe (Green), blank probe with only DHA (Sky blue), and c-Fos- immobilized probe (Red) without as negative controls.

By Anonymous

Target Background

Function
Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex, at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. In growing cells, activates phospholipid synthesis, possibly by activating CDS1 and PI4K2A. This activity requires Tyr-dephosphorylation and association with the endoplasmic reticulum.
Gene References into Functions
  1. our data suggested that purpurogallin inhibits osteoclast differentiation via downregulation of c-Fos and NFATc1 PMID: 29463002
  2. Both cyclic AMP responsive element binding protein (CREB)-dependent transcription and CPEB4-promoted translation support c-FOS expression early postnatal olfactory bulbs but disengage in adult olfactory bulbs PMID: 29166615
  3. We demonstrate that overexpression of Gfi1b, c-Fos, and Gata2, previously reported to transdifferentiate fibroblasts into hematopoietic progenitors in vitro, can induce long-term HSC formation in vivo. PMID: 28943250
  4. these data demonstrated that wedelolactone facilitated osteoblastogenesis through Wnt/GSK3beta/beta-catenin signaling pathway and suppressed RANKL-induced osteoclastogenesis through NF-kappaB/c-fos/NFATc1 pathway. PMID: 27558652
  5. The data of this study suggest that Fos expression during simple associative learning labels ensembles activated generally by arousal rather than specifically by a particular sensory cue. PMID: 28331016
  6. The specific expression of this long MEX3C isoform in oocytes and its ability to enhance FOS mRNA nuclear export and stability all suggest that MEX3C(659AA) is an RNA-binding protein that preserves maternal FOS mRNA in oocytes. PMID: 27053362
  7. we performed cotransfections of AP-1 expression plasmids with different mouse Gja1 promoter/luciferase reporter constructs within TM3 Leydig and TM4 Sertoli cells.We showed that a functional cooperation between cJun and cFos activates Gja1 expression and requires an AP-1 DNA regulatory element located between -132 and -26 bp PMID: 28903063
  8. hypergravity down-regulated c-fos expression transiently via ROCK/Rho-GTP and PI3K signaling. PMID: 28953959
  9. These findings suggested that the photoreceptor c-Fos controls blood vessel growth into the normally avascular photoreceptor layer through the inflammatory signal-induced STAT3/VEGFA pathway. PMID: 28465464
  10. c-FOS and DUSP1 expression levels determine the threshold of tyrosine kinase inhibitor (TKI) efficacy, such that growth-factor-induced expression of c-FOS and DUSP1 confers intrinsic resistance to TKI therapy in a wide-ranging set of leukemias. PMID: 28319094
  11. the protein and RNA levels of RANKLinduced cFos and nuclear factor of activated T-cell cytoplasmic 1 were suppressed by centipedegrass extract (CGE). These results indicated that CGE may serve as a useful drug in the prevention of bone loss. PMID: 27035226
  12. Fos and phosphorylation of extracellular signal-regulated kinases (ERK) were used to look for evidence that interneurons expressing GRP were activated following intradermal injection of chloroquine. PMID: 27270268
  13. this study shows that the inhibitory effect of tatrinan O on osteoclast formation is via decreasing the expression of NFATc1 and c-Fos PMID: 26971224
  14. The study quantified monosodium glutamate (MSG)--evoked brain activity, as measured by c-Fos, in the nucleus of the solitary tract (nTS). The number and pattern of c-Fos neurons in the nTS of animals that were water-restricted and received a constant infusion of MSG via intraoral cannula most closely mimicked animals that consumed MSG from a bottle. PMID: 26762887
  15. these results suggested that piperine inhibited osteoclast differentiation by suppressing the p38/NFATc1/c-Fos signaling axis PMID: 26627060
  16. Tumorigenesis by Meis1 overexpression is accompanied by a change of DNA target-sequence specificity which allows binding to the AP-1 element. PMID: 26259236
  17. this is the first report implicating M-CSF/DGKzeta/DAG axis as a critical regulator of bone homeostasis via its actions on OC differentiation and c-Fos expression. PMID: 25891971
  18. An intriguing finding was that S1P induced c-Fos-inhibited CCL5 directly and also indirectly through inhibition of the IFN-beta amplification loop PMID: 26246404
  19. These results suggest that c-Fos is involved in the normal development of Neural Stem Progenitor Cells PMID: 26143639
  20. Mechanistically, mTOR plays a crucial role in c-fos expression, thereby modulating NFkappaB binding to promoters of IL-12 and IL-10. PMID: 26122641
  21. cFOS plays a cell-specific role at multiple levels of the hypothalamic-pituitary-gonadal axis, affecting gonadotropes but not thyrotropes in the pituitary, and kisspeptin neurons but not GnRH neurons in the hypothalamus. PMID: 25958044
  22. These results suggest that TGF-beta regulates RANKL-induced osteoclastogenesis through reciprocal cooperation between Smad2/3 and c-Fos. PMID: 25431176
  23. measured gene expression of Fos, Per1 and Sgk1 45 min after exposure to brief cold swim stress in male and female mice; stress induced a stronger increase in Fos and Per1 expression in females than males PMID: 25459888
  24. Transcriptional activity of early genes involved in memory process, such as FBJ osteosarcoma oncogene (Fos) is increased in the hippocampus of hypercholesterolemic LDL receptor knockout mice. PMID: 25797218
  25. Spontaneous seizures in Kcna1-null mice activate Fos expression in select limbic circuits PMID: 26112121
  26. c-Fos expression in the dorsal hippocampus of Gria1-/- mice PMID: 25446922
  27. This study finding of a correlation between SERT and c-FOS protein expression affected by PS, together with related mRNAs. PMID: 25102410
  28. Results show a difference in Fos expression in the hippocampus between B6 and D2 mice after 1 flurothyl-induced seizure PMID: 25524858
  29. Data show that retinoic acid receptor gamma (RARgamma)-proto-oncogene protein c-fos (c-Fos)-PPARgamma2 (PPARgamma2) signaling rather than reactive oxygen species generation is critical for all-trans retinoic acid (ATRA)-inhibited adipocyte differentiation. PMID: 25173565
  30. Data suggest that p38 MAP kinase regulates c-fos/cellular oncogene fos mRNA stability/decay by affecting state of phosphorylation of Elavl1/HuR (Hu antigen R). PMID: 25588078
  31. c-Fos expression in the medial preoptic area (mPOA) was significantly higher in sires that exhibited retrieval behavior (retrievers) than those with no such behavior (non-retrievers). PMID: 25208928
  32. Pik3cd inactivation leads to extracellular matrix degradation in vessels and promotes aneurysm development by inducing macrophage migration and upregulating the activator protein-1/MMP-12 pathway in macrophages. PMID: 25503990
  33. The results of this study conclude that fosGFP expression discriminates between single- and multi-whisker receptive field layer 2 pyramidal neurons. PMID: 25453844
  34. Data suggest that c-Fos (not c-Jun) regulates phospholipid synthesis in cell nucleus; c-Fos localizes to nucleus and modulates genetic transcription through activation of Pip5k1 (phosphatidylinositol-4-monophosphate 5-kinase). PMID: 24819416
  35. the distinct requirement of NF-kappaB for mouse and human c-fos regulation PMID: 24386331
  36. The expression of the c-fos gene increased the most among phencyclidine-dependent differentially expressed genes between WT and GluN2D knockout out mice. PMID: 24330819
  37. Heterogeneous nuclear ribonucleoprotein R cooperates with mediator to facilitate transcription reinitiation on the c-Fos gene. PMID: 23967313
  38. analysis of the temporal pattern in cfos activation in cortical and brainstem areas implicated in the control of appetite and body weight regulation PMID: 24424063
  39. Using transgenic mice overexpressing the AP-1 inhibitor JDP2, a central role of AP-1 in the induction of hypertrophy and apoptosis in cardiomyocytes is demonstrated. PMID: 23612584
  40. Orientation within a high magnetic field determines swimming direction and c-Fos induction in brain stem vestibular nuclei. PMID: 23720133
  41. c-Fos transcriptionally controls mmp10 and s100a7a15 expression in keratinocytes, subsequently leading to CD4 T-cell recruitment to the skin, thereby promoting epidermal hyperplasia that is likely induced by CD4 T-cell-derived IL-22 PMID: 24029918
  42. the restructuring of muscarinic receptor mRNA correlations reveals an additional mechanism for adaptation to the c-fos gene knockout PMID: 23395867
  43. The inhibitory effect of inflammation and tensile strain on osteogenicity is associated with the upregulation in c-fos expression. PMID: 23727355
  44. this study examined c-Fos expression induced by repeated maternal separation andsingle time maternal separation in pre-weaned mice, with the aim of determining whether newborn animals become desensitised to repeated maternal absence. I PMID: 22913644
  45. the role of GnRH in the regulation of gonadotropin gene expression is seen by highlighting the role of c-Fos posttranslational modification that may cause higher levels of FSH during the time of low GnRH pulse frequency to stimulate follicular growth. PMID: 23275456
  46. c-Fos and polo-like kinase 2 induction is impaired in the limbic system of fear-conditioned alpha-synuclein transgenic mice PMID: 23209687
  47. Data indicate that FOS, SPI1, KLF10, TFEC, and PRDM16 show robust transcriptional cross-regulation and are often associated with osteoclastogenesis. PMID: 23340137
  48. ApoE plays an inhibitory role in osteoclast differentiation via the suppression of RANKL-dependent activation of NF-kappaB and induction of c-Fos and NFATc1. PMID: 23246654
  49. Data suggest that miR-181a attenuates ox-LDL-stimulated immune inflammation responses by targeting c-Fos in dendritic cells. PMID: 22956783
  50. hypothalamic c-Fos activation is regulated by daily scheduled high fat meals in mice PMID: 22815954

Show More

Hide All

Subcellular Location
Nucleus. Endoplasmic reticulum. Cytoplasm, cytosol.
Protein Families
BZIP family, Fos subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*