Recombinant Mycoplasma pneumoniae P30 adhesin (p30), partial

In Stock
Code CSB-EP301931MLW1
Abbreviation Recombinant Mycoplasma pneumoniae P30 adhesin protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
p30
Uniprot No.
Research Area
Neuroscience
Alternative Names
p30; MPN_453; MP388; P30 adhesin; 30 kDa adhesin-related protein; Cytadhesin P30
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Source
E.coli
Expression Region
106-274aa
Target Protein Sequence
RLLEEKERQEQLAEQLQRISAQQEEQQALEQQAAAEAHAEAEVEPAPQPVPVPPQPQVQINFGPRTGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMQPPRPGMPPQPGFPPKR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.6 kDa
Protein Length
partial
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Our Recombinant Mycoplasma pneumoniae P30 adhesin is a meticulously engineered reproduction of the P30 adhesin (30 kDa adhesin-related protein; Cytadhesin P30) protein, found in the Mycoplasma pneumoniae strain ATCC 29342 / M129. This protein, significant for its role in neuroscience research, is designed to match the native form as closely as possible to ensure accurate experimental results.

Expressed in E.coli, our recombinant protein covers a partial span of the original, encompassing the 106-274aa expression region of the P30 adhesin. To aid with detection and purification in your lab work, the protein comes with an N-terminal 6xHis-GST-tag. Purity of the Recombinant Mycoplasma pneumoniae P30 adhesin is confirmed to be over 85% via SDS-PAGE analysis, demonstrating its high quality and performance capabilities for your research.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Adhesin necessary for successful cytadherence and virulence.
Gene References into Functions
  1. Posttranslational processing is required for fully functional of P30 in cell gliding and cytadherence. PMID: 21821772
Subcellular Location
Cell projection, attachment organelle membrane; Multi-pass membrane protein. Note=Integral and surface exposed membrane protein that localizes to the membrane at the attachment organelle.
Database Links

KEGG: mpn:MPN453

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*