Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
p30; MPN_453; MP388; P30 adhesin; 30 kDa adhesin-related protein; Cytadhesin P30
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Expression Region
106-274aa
Target Protein Sequence
RLLEEKERQEQLAEQLQRISAQQEEQQALEQQAAAEAHAEAEVEPAPQPVPVPPQPQVQINFGPRTGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMQPPRPGMPPQPGFPPKR
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer，50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Our Recombinant Mycoplasma pneumoniae P30 adhesin is a meticulously engineered reproduction of the P30 adhesin (30 kDa adhesin-related protein; Cytadhesin P30) protein, found in the Mycoplasma pneumoniae strain ATCC 29342 / M129. This protein, significant for its role in neuroscience research, is designed to match the native form as closely as possible to ensure accurate experimental results.
Expressed in E.coli, our recombinant protein covers a partial span of the original, encompassing the 106-274aa expression region of the P30 adhesin. To aid with detection and purification in your lab work, the protein comes with an N-terminal 6xHis-GST-tag. Purity of the Recombinant Mycoplasma pneumoniae P30 adhesin is confirmed to be over 85% via SDS-PAGE analysis, demonstrating its high quality and performance capabilities for your research.
