Home
Protein
Recombinant Proteins
Recombinant Mycoplasma pneumoniae P30 adhesin (p30), partial

Recombinant Mycoplasma pneumoniae P30 adhesin (p30), partial

^{In Stock}

Code	CSB-EP301931MLW1
Abbreviation	Recombinant Mycoplasma pneumoniae P30 adhesin protein, partial
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

p30

Uniprot No.

P75330

Research Area

Neuroscience

Alternative Names

p30; MPN_453; MP388; P30 adhesin; 30 kDa adhesin-related protein; Cytadhesin P30

Species

Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Source

E.coli

Expression Region

106-274aa

Target Protein Sequence

RLLEEKERQEQLAEQLQRISAQQEEQQALEQQAAAEAHAEAEVEPAPQPVPVPPQPQVQINFGPRTGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMQPPRPGMPPQPGFPPKR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

49.6 kDa

Protein Length

partial

Tag Info

N-terminal 6xHis-GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Our Recombinant Mycoplasma pneumoniae P30 adhesin is a meticulously engineered reproduction of the P30 adhesin (30 kDa adhesin-related protein; Cytadhesin P30) protein, found in the Mycoplasma pneumoniae strain ATCC 29342 / M129. This protein, significant for its role in neuroscience research, is designed to match the native form as closely as possible to ensure accurate experimental results.

Expressed in E.coli, our recombinant protein covers a partial span of the original, encompassing the 106-274aa expression region of the P30 adhesin. To aid with detection and purification in your lab work, the protein comes with an N-terminal 6xHis-GST-tag. Purity of the Recombinant Mycoplasma pneumoniae P30 adhesin is confirmed to be over 85% via SDS-PAGE analysis, demonstrating its high quality and performance capabilities for your research.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Adhesin necessary for successful cytadherence and virulence.

Gene References into Functions

Posttranslational processing is required for fully functional of P30 in cell gliding and cytadherence. PMID: 21821772

Subcellular Location

Cell projection, attachment organelle membrane; Multi-pass membrane protein. Note=Integral and surface exposed membrane protein that localizes to the membrane at the attachment organelle.

Database Links

KEGG: mpn:MPN453

Promotions