Product Details

Purity

Greater than ≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 7.716-15.52 pg/mL.
②Measured by its binding ability in a functional ELISA.Immobilized Rat Tnf at 4 μg/mL can bind Human TNFRSF1A(CSB-MP023977HU1). The EC50 is 6.174-7.463 ng/mL.
③Measured by its binding ability in a functional ELISA.Immobilized Rat Tnf at 4 μg/mL can bind Rat Tnfrsf1a(CSB-MP023977RA). The EC50 is 66.99-76.40 ng/mL.
④Human TNFRSF1A(MP023977HU1) captured on Protein A Chip can bind Recombinant Rat Tnf with an affinity constant of 0.139 nM as detected by MetaSPR Assay (WeSPRTM 200).

Target Names

Tnf

Uniprot No.

P16599

Alternative Names

Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2 (TNF-a); Tumor necrosis factor, membrane form Alternative names: N-terminal fragment (NTF); Intracellular domain 1 (ICD1); Intracellular domain 2 (ICD2); C-domain 1; C-domain 2; Tumor necrosis factor, soluble form; Tnf; Tnfa, Tnfsf2

Species

Rattus norvegicus (Rat)

Source

Mammalian cell

Expression Region

80-235aa

Target Protein Sequence

LRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL

Mol. Weight

18.7 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

TNF-α drives apoptosis, inflammation, and immune cell activation through TNFR1 and TNFR2 signaling, making precise control of its bioactivity essential for mechanistic studies in cancer and inflammatory disease models. This mammalian-expressed rat TNF (aa 80–235) demonstrates potent cytotoxic activity with an ED50 of 7.7–15.5 pg/mL in L-929 fibroblast assays and binds human TNFRSF1A with an EC50 of 6.2–7.5 ng/mL and a KD of 0.139 nM, confirming receptor engagement at physiologically relevant concentrations suitable for NF-κB and MAPK pathway activation studies, apoptosis assays in tumor cell lines, and in vivo inflammation models. The endotoxin level below 1.0 EU/μg prevents LPS-driven artifacts that confound interpretation in macrophage, dendritic cell, and primary immune cell experiments where TNF and TLR4 pathways converge. Purity exceeding 95% supports its use as a coating antigen in ELISA development and as a reference standard in cytokine detection platforms.

Target Background

Function

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6.; The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.

Subcellular Location

Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, membrane form]: Membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, soluble form]: Secreted.; [C-domain 1]: Secreted.; [C-domain 2]: Secreted.

Protein Families

Tumor necrosis factor family

Database Links

KEGG: rno:103694380

STRING: 10116.ENSRNOP00000001110

UniGene: Rn.2275

Code	CSB-MP325438RA
Abbreviation	Recombinant Rat Tnf protein, partial (Active)
MSDS	MSDS Datasheet
Size	$118
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED₅₀ for this effect is 7.716-15.52 pg/mL. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA.Immobilized Rat Tnf at 4 μg/mL can bind Human TNFRSF1A(CSB-MP023977HU1). The EC50 is 6.174-7.463 ng/mL. Activity Measured by its binding ability in a functional ELISA.Immobilized Rat Tnf at 4 μg/mL can bind Rat Tnfrsf1a(CSB-MP023977RA). The EC50 is 66.99-76.40 ng/mL. Activity Human TNFRSF1A(MP023977HU1) captured on Protein A Chip can bind Recombinant Rat Tnf with an affinity constant of 0.139 nM as detected by MetaSPR Assay (WeSPRTM 200).
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Tumor necrosis factor (Tnf), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage