Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
tstToxic shock syndrome toxin-1; TSST-1
Species
Staphylococcus aureus
Expression Region
41-234aa
Target Protein Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Delve into cutting-edge immunological research with our Recombinant Staphylococcus aureus tst. This product features Toxic shock syndrome toxin-1 (TSST-1), a potent exotoxin known for its involvement in toxic shock syndrome, one of the severe outcomes of Staphylococcus aureus infections. TSST-1 is recognized for its superantigenic properties, stimulating T-cell proliferation and cytokine release, which provides an exciting avenue for immunological and infectious disease research.
This recombinant protein covers the full length of the mature TSST-1, specifically the amino acid region from 41-234. It's expressed in E.coli, and it carries an N-terminal 6xHis-SUMO-tag for ease in purification and detection. Quality is assured, as the Recombinant Staphylococcus aureus tst shows a purity greater than 90%, as determined by SDS-PAGE. Depending on your research needs, the product comes as a liquid solution or as a lyophilized powder. This product is an excellent choice for research focusing on Staphylococcus aureus pathogenicity, superantigen behavior, and immune responses.
