Recombinant Human T-lymphocyte activation antigen CD86 (CD86), partial (Active)

In Stock
Code CSB-AP005161HU
Abbreviation Recombinant Human CD86 protein, partial (Active)
MSDS
Size $96
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CTLA-4-Fc-Avi at 5μg/ml can bind Human B7-2-His, the ED50 of Recombinant Human B7-2-His is 1.19 μg/ml.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
CD86; CD28LG2; T-lymphocyte activation antigen CD86; Activation B7-2 antigen; B70; BU63; CTLA-4 counter-receptor B7.2; FUN-1; CD antigen CD86
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
24-247aa
Complete Sequence
APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
Mol. Weight
26.69 kDa
Protein Length
Extracellular Domain
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : As control proteins

Review: To verify the specificity of the sensor for CEA detection, control experiments were carried out by using BSA, PSA, CD86 and EpCAM as control proteins. As shown in Fig. 4C, an obvious current was obtained in buffer containing CEA while only negligible currents were obtained in control groups containing BSA, PSA, CD86 and EpCAM even at a 10-fold concentration of CEA, indicating the specificity of the sensor.

By Anonymous

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*