Recombinant Human T-lymphocyte activation antigen CD86(CD86),partial (Active)

In Stock
Code CSB-AP005161HU
Size US$2376Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to bind Human CTLA-4 in functional ELISA is less than 20 ug/ml.
Target Names CD86
Uniprot No. P42081
Research Area Immunology
Alternative Names Activation B7-2 antigen 3; Activation B7-2 antigen; B-lymphocyte activation antigen B7-2 2; B-lymphocyte activation antigen B7-2; B7 2; B7; B7-2; B7.2; B70; B72; B72 antigen; BU63; CD28 antigen ligand 2 2; CD28 antigen ligand 2; Cd28l2; CD28LG2; CD86; CD86 antigen (CD28 antigen ligand 2 B7 2 antigen); CD86 antigen (CD28 antigen ligand 2; B7-2 antigen) 1; 2; CD86 antigen (CD28 antigen ligand 2; B7-2 antigen); CD86 antigen; CD86 molecule; CD86_HUMAN; CLS1; CTLA-4 counter-receptor B7.2 2; CTLA-4 counter-receptor B7.2 2; 3; CTLA-4 counter-receptor B7.2; Early T-cell costimulatory molecule 1; ETC-1; FUN 1; FUN-1; FUN1; LAB72; Ly-58; Ly58; MB7; MB7-2; Membrane glycoprotein ; MGC34413; T lymphocyte activation antigen CD86 precursor; T-lymphocyte activation antigen CD86; TS/A-2
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 24-247aa
Complete Sequence APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
Mol. Weight 26.69 kDa
Protein Length Extracellular Domain
Tag Info C-terminal 6xHis-tagged
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation.; FUNCTION
Gene References into Functions
  1. Hepatitis C virus has a genetically determined lymphotropism through co-receptor B7.2. PMID: 28067225
  2. this study shows that recipients' CD86 gene polymorphisms influence the overall survival after allogeneic hematopoietic stem cell transplantation and, together with CTLA-4 polymorphisms, might be considered a risk factor for acute graft versus host disease PMID: 29577049
  3. results strongly suggest that CD40 and CD86 play a role in the pathophysiology of oral inflammatory diseases such as OLP PMID: 28904313
  4. Our results reveal a role for B7-2 as obligatory receptor for superantigens. B7-2 homodimer interface mimotopes prevent superantigen lethality by blocking the superantigen-host costimulatory receptor interaction. PMID: 27708164
  5. Our study reports a novel association of SNPs within CD86 and CTLA4 genes with pemphigus. The CD86 rs1129055 A allele appears to confer susceptibility to Pemphigus vulgaris but not to pemphigus foliaceus. PMID: 28274366
  6. Our data demonstrate that CML patients with high CD86(+)pDC counts have a higher risk of relapse after TKI discontinuation. PMID: 28074067
  7. IL-6, DEC205, and CD86 can be predictive biomarkers for the respiratory and immune effects of ambient PM2.5. PMID: 28056587
  8. the upregulation of CD86 but not CD80 and PD-L1 on CD68+ cells in the liver of HBV-infected patients, observed in our study, suggest that the profile of CD68+ cells does not support the induction of proper Th1 responses that are needed to clear HBV infection. This might provide an explanation for the absence of potent HBV-specific T cells during chronic HBV infection. PMID: 27348308
  9. CD86 variants association with susceptibility to multiple sclerosis in Iranian population. PMID: 28079472
  10. B-cells from patients tolerant to the graft maintained higher IL-10 production after CD40 ligation, which correlates with lower CD86 expression compared to patients with chronic rejection. PMID: 26795594
  11. TLR2, TLR4 and CD86 gene polymorphisms are associated with Recurrent aphthous stomatitis. PMID: 25482673
  12. The SNP CD40 -1C>T was associated with the IgG response against PvDBP, whereas IgG antibody titers against PvMSP-119 were influenced by the polymorphism CD86 +1057G>A. PMID: 26901523
  13. PD-L1 expression and the PD-L1/CD86 ratio in CD14(++)CD16(+) monocytes were higher during chronic hepatitis C virus infection. PMID: 24531620
  14. Data show that induction of CD86 antigen expression on monocytes by human beta Defensin-3 (hBD-3) is suppressed by P2X7 purinoceptor (P2X7R) antagonist. PMID: 26416278
  15. analysis of the expression of TLR-9, CD86, and CD95 in circulating B cells of patients with chronic viral hepatitis B or C before and after antiviral therapy PMID: 25892855
  16. Polymorphisms in CD86 gene have diverse effects on the pathogenesis of pneumonia-induced sepsis. PMID: 25129060
  17. CD86 +1057G/A polymorphism may be not associated with the genetic susceptibility to chronic immune thrombocytopenia in a Chinese population. PMID: 24897540
  18. CD86 polymorphisms are associated with susceptibility to pneumonia-induced sepsis and may affect gene expression in monocytes. PMID: 25912130
  19. CD86 polymorphisms (rs1129055) may have protective effects on cancer risk in Asians and that CD86 polymorphisms (rs17281995) is likely to contribute to risk of cancer, particularly colorectal cancer in Caucasians. PMID: 25369324
  20. Results support a CTLA4-Ig/CD86 interaction on gammaIFN and IL-17 activated endothelial cells that modulates the expression of VEGFR-2 and ICAM1. PMID: 25896473
  21. B7-2 costimulation and intracellular indoleamine 2,3-dioxygenase expression is reduced in umbilical cord blood as compared to adult peripheral blood. PMID: 24930629
  22. Meningococcal capsular polysaccharide-loaded vaccine nanoparticles induce expression of CD86. PMID: 24981893
  23. the higher levels of sCTLA-4 and CD86 in B-ALL patients might be candidate parameters for poor prognosis and may serve to refine treatment stratification with intensification of therapy in those patients prone to relapse. PMID: 24283754
  24. no statistically significant difference between brucellosis patients and controls in the allele and genotype distributions of CTLA4, +49A/G (P = 0.859) and CD86, +2379G/C (P = 0.476) was found. PMID: 24298899
  25. Cirrhotic patients with type 2 diabetes have increased expression of monocytic CD86 in comparison with cirrhotic non-diabetic, diabetic and healthy controls. This increases significantly with increase of the stage of the Child-Pugh score. PMID: 24378263
  26. Provide evidence for an involvement of CD40+ and CD86+ B cells in the incidence of stroke and suggest that both pathogenic and protective B cell subsets exist. PMID: 24202305
  27. Our results indicate that the methylation pattern in the CD86 promoter and CpG island is closely related to the expression of this co-stimulatory molecule in keratinocytes. PMID: 23867827
  28. We failed to find any significant association of the 2 CD86 SNPs with RA. PMID: 23661460
  29. Myeloid leukemia cells with a B7-2(+) subpopulation provoke Th-cell responses and become immuno-suppressive through the modulation of B7 ligands. PMID: 23175469
  30. The frequency of the CD86 gene +1057A allele was significantly higher in pancreatic cancer cases than in controls. PMID: 22821131
  31. CD86 and IL-12p70 are key players for T helper 1 polarization and natural killer cell activation by Toll-like receptor-induced dendritic cells. PMID: 22962607
  32. Interaction of CD28 with B7 costimulatory antigen promotes proliferation and survival of activated gammadelta T cells following Plasmodium infection. PMID: 22732586
  33. these results reveal the critical importance of the cytoskeleton-dependent CD86 polarization to the IS and more specifically the K4 motif for effective co-signaling. PMID: 22659416
  34. CD86 represents an important tool for subdividing HSCs in several circumstances, identifying those unlikely to generate a full spectrum of hematopoietic cells. PMID: 22371880
  35. Phe119 and Ser120 in the MIR2 ITM region and Asp244 in the B7-2 JM region contribute to the recognition of B7-2 by MIR2. PMID: 22379101
  36. The +1057G/A polymorphism of the CD86 gene is associated with increased susceptibility to Ewing's sarcoma. PMID: 21870962
  37. Data suggest that expression of CD86, CD80, and CD40 on dendritic cells in normal endometrium is higher than on tumor infiltrating dendritic cells in endometrioid adenocarcinoma; this may reflect roles in antigen presentation/tumor escape. PMID: 22142817
  38. primary liver disease could influence the pre-transplantation levels of sCD86 and sCD95L. High pre-transplantation serum levels of sCD86 could favor the development of episodes of acute rejection. PMID: 22182632
  39. IL-2 upregulates CD86 expression on human CD4(+) and CD8(+) T cells via a receptor-dependent mechanism that involves the NFAT and mammalian target of rapamycin pathways. PMID: 22246628
  40. Yeast-derived beta-glucan lacks cytotoxic effects towards B-lymphoma cells but up-regulation of CD86 suggests maturation of the cells via dectin-1 by the carbohydrate PMID: 22199280
  41. the +1057G/A polymorphism of the CD86 gene is associated with increased susceptibility to osteosarcoma PMID: 21563968
  42. Parasite-induced B7-2 is dependent on Jun N-terminal protein kinase (JNK) but not extracellular signal-regulated kinase or p38 signaling; its expression on human peripheral blood monocytes is dependent on JNK signaling. PMID: 21911468
  43. AA genotype and A allele of CD86 +1057G>A polymorphism may confer a protection against acute kidney allograft rejection in Tunisian patients. PMID: 21525579
  44. Allergen exposure needs to cause weak or moderate cytotoxicity for DD86 and CD54 expression. PMID: 21628959
  45. After surgery the rate of monocytes expressing B7-2 decreased in all the patients PMID: 21540807
  46. genetic polymorphism is associated with risk or protection for chronic obstructive pulmonary disease in Chinese population PMID: 20732370
  47. In the absence of irradiated M. tuberculosis, dendritic cells consist in a major DC-SIGN(high)/CD86(low) and minor DC-SIGN(low)/CD86(high) subpopulations, whereas in the presence of bacteria, there is an enrichment of DC-SIGN(low)/CD86(high) population. PMID: 20212510
  48. In active ulcerative colitis CD86 and ICOS were over-expressed in the intestinal epithelial cells and lamina propria mononuclear cells. PMID: 20388394
  49. Increased amount of CD86 or ICOS positive lamina propria mononuclear cells and enterocytes suggests that co-stimulatory molecules may play a role in the pathogenesis of Crohn disease. PMID: 20019769
  50. Expansion of donor-derived lymphocytic choriomeningitis virus (LCMV)-specific CD4+ and CD8+ T cells is significantly impaired in B7.1/B7.2-deficient T cell receptor (TCR)transgenic recipients, compared with wild-type. PMID: 20601595
  51. Data suggest that CD86 and 1057G/A polymorphism may contribute to genetic susceptibility to colorectal neoplasms in a Chinese population. PMID: 20380573
  52. Abnormal expression of TLR3 and CD86 may relate to the persistence of HBV infection. PMID: 17963596
  53. CD86 +1057G/A polymorphism may not be associated with coronary artery disease in the Chinese population. PMID: 20230296
  54. Data show that the expression of CD86 was different from other activation markers, because expression was delayed after in vitro TCR stimulation and required sufficient IL-2 signaling. PMID: 20100932
  55. increased expression on dendritic cells from systemic lupus erythematosus patients PMID: 20067533
  56. Structure in complex with CTLA-4; may represent a distinct signalling mechanism available to dimeric cell-surface receptors. PMID: 11279501
  57. In AML, CD86 is a marker of monocytic/dendritic lineage PMID: 11823047
  58. a soluble form of CD86 encoded by an alternatively spliced transcript is present at elevated levels in blood in some leukaemia patients PMID: 11986949
  59. expression, refolding, purification, characterization, and crystallization of the receptor-binding domain of human B7-2 is described; glycosylation is not important for proper folding of the receptor-binding domain of B7-2 nor for its binding to CTLA-4 PMID: 12071705
  60. Leishmania major infection of macrophages cocultured with neutrophils results in a neutrophil-macrophage interaction via CD86 leading to IFN-gamma secretion and restriction of Leishmania growth. PMID: 12097397
  61. Impaired up-regulation of CD70 and CD86 in naive B cells from patients with CVID suggests an intrinsic signalling or expression defect at the level of naive B cells in type I CVID. PMID: 12100033
  62. polymorphisms have no association with type I diabetes among Finnish subjects PMID: 12187923
  63. Intense expression is an unfavorable prognostic indicator for differentiated thyroid carcinoma of children and adolescents PMID: 12213904
  64. Data show that interaction between iC3b-opsonized apoptotic cells and immature dendritic cells down-regulated the expression of CD86 and up-regulated expression of CC chemokine receptor 7. PMID: 12486098
  65. c-MIR induced specific down-regulation of B7-2 surface expression through ubiquitination, rapid endocytosis, and lysosomal degradation PMID: 12582153
  66. B7-2 dimer observed in the B7-2/CTLA-4 complex displays a very hydrophilic dimer interface which provides a mechanism for preventing the formation of B7-1/B7-2 heterodimers PMID: 12606712
  67. A key mechanism in the pathogenesis of MS is the increased expression of CD86 and CD40L and the increased production of IL12 during disease progression. PMID: 12672403
  68. Decreased expression of CD86 antigen is associated with melanoma PMID: 14727087
  69. CD86 and CD80 have opposite roles in the functioning of human regulatory T cells via CTLA-4 and CD28, an observation that has significant implications for manipulation of immune responses and tolerance in vivo. PMID: 14978077
  70. PIII also promoted a significant increase in the percentage of cells expressing CD86 PMID: 15019278
  71. CTLA-4 gene polymorphism may not play a role in the development of rheumatoid arthritis in Chinese. PMID: 15045639
  72. CD86 may play an important role in asthma pathogenesis. PMID: 15059478
  73. kK5 proteins of Kaposi's sarcoma associated herepsvirus does not affect class I expression but does downregulate human B7.2 molecules in a TAP/tapasin-independent manner PMID: 15280476
  74. CD86 was found to be concentrated within the cytoplasmic vesicles of macrophages and dendritic cells. PMID: 15623548
  75. NF-kappaB signal plays a key role in LIGHT-mediated upregulation of CD86 expression. PMID: 15895390
  76. Results indicate the expression of functional B7.2 molecule may facilitate progression of acute myeloid leukemia. PMID: 16115907
  77. CD86 AA genotype at +1057 position could be involved in liver transplant acceptance, given that its presence is related to a decrease of acute rejection frequency and to a graft survival increase. PMID: 16223675
  78. Expression of CD86 on keratinocytes from normal cervical epithelium but not on HPV-16 positive lesions could be a mechanism for evading host immune surveillance. PMID: 17386046
  79. The CD86 gene, and specifically the Ile179Val polymorphism, may be a novel aetiological factor in the development of asthma and related allergic disorders. PMID: 17513529
  80. Expression of CD86 and CD80 costimulatory molecules appears to be a marker of better clinical outcome and survival in patients with nasopharyngeal carcinoma. PMID: 17524139
  81. while CD86 does not stimulate an initial response as strongly as CD80, there is greater sustained activity that is seen even in the absence of continued costimulation PMID: 17947667
  82. CD86 was constitutively expressed on circulating monocytes in healthy individuals and levels were decreased in septic subjects on Day 1 PMID: 17989345
  83. Dendritic cells obtained from Crohn's disease patients with mutations in the NOD2 gene display an activated phenotype characterized by high CD86 expression. PMID: 18069758
  84. possible functional relationship between the enhanced incidence of precursor plasmacytoid dendritic cells, their comparatively high relative expression of the coinhibitory molecule PD-L1 PMID: 18301333
  85. Generation of a novel alternate transcript of the B7-2 costimulatory molecule (B7-2C) by the splicing of exon 4 appears to represent a mechanism for the fine tuning of full-length protein B7-2A-mediated costimulatory signals. PMID: 18322188
  86. CD86 was differentially expressed in both macrophages and foam cells from subjects with atherosclerosis. PMID: 18506362
  87. The expression levels of B7.2 were low on day 1 in S7, S10 and H37Ra Mycobacterium tuberulosis infected monocyte derived macrophages PMID: 18577795
  88. Monocytes of chronic graft-versus-host disease patients had greater CD86 mean fluorescence intensity in marrow. PMID: 18580477
  89. A novel role is found for CD86 expression on the microvasculature, whereby ligation of CTLA-4 on CD4-positive T cells by CD86 on islet endothelial cells is key to the adhesion of recently activated T cells. PMID: 18941200
  90. human APCs in which CREMalpha was selectively suppressed expressed more CD86 on the surface membrane PMID: 19299714
  91. B7-2 expression in chronic B cell lymphocytic leukemia patients is significantly lower; interferon-gamma could induce B7-2 expression slightly PMID: 19430862

Show More

Hide All

Subcellular Location Cell membrane, Single-pass type I membrane protein
Tissue Specificity Expressed by activated B-lymphocytes and monocytes.
Database Links

HGNC: 1705

OMIM: 601020

KEGG: hsa:942

STRING: 9606.ENSP00000332049

UniGene: Hs.171182

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1