Recombinant Human T-lymphocyte activation antigen CD86(CD86),partial (Active)

In Stock
Code CSB-AP005161HU
Size US$2376Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to bind Human CTLA-4 in functional ELISA is less than 20 ug/ml.
Target Names CD86
Uniprot No. P42081
Research Area Immunology
Alternative Names Activation B7-2 antigen 3; Activation B7-2 antigen; B-lymphocyte activation antigen B7-2 2; B-lymphocyte activation antigen B7-2; B7 2; B7; B7-2; B7.2; B70; B72; B72 antigen; BU63; CD28 antigen ligand 2 2; CD28 antigen ligand 2; Cd28l2; CD28LG2; CD86; CD86 antigen (CD28 antigen ligand 2 B7 2 antigen); CD86 antigen (CD28 antigen ligand 2; B7-2 antigen) 1; 2; CD86 antigen (CD28 antigen ligand 2; B7-2 antigen); CD86 antigen; CD86 molecule; CD86_HUMAN; CLS1; CTLA-4 counter-receptor B7.2 2; CTLA-4 counter-receptor B7.2 2; 3; CTLA-4 counter-receptor B7.2; Early T-cell costimulatory molecule 1; ETC-1; FUN 1; FUN-1; FUN1; LAB72; Ly-58; Ly58; MB7; MB7-2; Membrane glycoprotein ; MGC34413; T lymphocyte activation antigen CD86 precursor; T-lymphocyte activation antigen CD86; TS/A-2
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 24-247aa
Complete Sequence APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
Mol. Weight 26.69 kDa
Protein Length Extracellular Domain
Tag Info C-terminal 6xHis-tagged
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Citations

Construction of electrochemical aptasensor of carcinoembryonic antigen based on toehold-aided DNA recycling signal amplification. RenZhang,Bioelectrochemistry,2020

Applications: As control proteins
Review: To verify the specificity of the sensor for CEA detection, control experiments were carried out by using BSA, PSA, CD86 and EpCAM as control proteins. As shown in Fig. 4C, an obvious current was obtained in buffer containing CEA while only negligible currents were obtained in control groups containing BSA, PSA, CD86 and EpCAM even at a 10-fold concentration of CEA, indicating the specificity of the sensor.
PMID: 32120323

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation.; FUNCTION
Gene References into Functions
  1. Hepatitis C virus has a genetically determined lymphotropism through co-receptor B7.2. PMID: 28067225
  2. this study shows that recipients' CD86 gene polymorphisms influence the overall survival after allogeneic hematopoietic stem cell transplantation and, together with CTLA-4 polymorphisms, might be considered a risk factor for acute graft versus host disease PMID: 29577049
  3. results strongly suggest that CD40 and CD86 play a role in the pathophysiology of oral inflammatory diseases such as OLP PMID: 28904313
  4. Our results reveal a role for B7-2 as obligatory receptor for superantigens. B7-2 homodimer interface mimotopes prevent superantigen lethality by blocking the superantigen-host costimulatory receptor interaction. PMID: 27708164
  5. Our study reports a novel association of SNPs within CD86 and CTLA4 genes with pemphigus. The CD86 rs1129055 A allele appears to confer susceptibility to Pemphigus vulgaris but not to pemphigus foliaceus. PMID: 28274366
  6. Our data demonstrate that CML patients with high CD86(+)pDC counts have a higher risk of relapse after TKI discontinuation. PMID: 28074067
  7. IL-6, DEC205, and CD86 can be predictive biomarkers for the respiratory and immune effects of ambient PM2.5. PMID: 28056587
  8. the upregulation of CD86 but not CD80 and PD-L1 on CD68+ cells in the liver of HBV-infected patients, observed in our study, suggest that the profile of CD68+ cells does not support the induction of proper Th1 responses that are needed to clear HBV infection. This might provide an explanation for the absence of potent HBV-specific T cells during chronic HBV infection. PMID: 27348308
  9. CD86 variants association with susceptibility to multiple sclerosis in Iranian population. PMID: 28079472
  10. B-cells from patients tolerant to the graft maintained higher IL-10 production after CD40 ligation, which correlates with lower CD86 expression compared to patients with chronic rejection. PMID: 26795594
  11. TLR2, TLR4 and CD86 gene polymorphisms are associated with Recurrent aphthous stomatitis. PMID: 25482673
  12. The SNP CD40 -1C>T was associated with the IgG response against PvDBP, whereas IgG antibody titers against PvMSP-119 were influenced by the polymorphism CD86 +1057G>A. PMID: 26901523
  13. PD-L1 expression and the PD-L1/CD86 ratio in CD14(++)CD16(+) monocytes were higher during chronic hepatitis C virus infection. PMID: 24531620
  14. Data show that induction of CD86 antigen expression on monocytes by human beta Defensin-3 (hBD-3) is suppressed by P2X7 purinoceptor (P2X7R) antagonist. PMID: 26416278
  15. analysis of the expression of TLR-9, CD86, and CD95 in circulating B cells of patients with chronic viral hepatitis B or C before and after antiviral therapy PMID: 25892855
  16. Polymorphisms in CD86 gene have diverse effects on the pathogenesis of pneumonia-induced sepsis. PMID: 25129060
  17. CD86 +1057G/A polymorphism may be not associated with the genetic susceptibility to chronic immune thrombocytopenia in a Chinese population. PMID: 24897540
  18. CD86 polymorphisms are associated with susceptibility to pneumonia-induced sepsis and may affect gene expression in monocytes. PMID: 25912130
  19. CD86 polymorphisms (rs1129055) may have protective effects on cancer risk in Asians and that CD86 polymorphisms (rs17281995) is likely to contribute to risk of cancer, particularly colorectal cancer in Caucasians. PMID: 25369324
  20. Results support a CTLA4-Ig/CD86 interaction on gammaIFN and IL-17 activated endothelial cells that modulates the expression of VEGFR-2 and ICAM1. PMID: 25896473
  21. B7-2 costimulation and intracellular indoleamine 2,3-dioxygenase expression is reduced in umbilical cord blood as compared to adult peripheral blood. PMID: 24930629
  22. Meningococcal capsular polysaccharide-loaded vaccine nanoparticles induce expression of CD86. PMID: 24981893
  23. the higher levels of sCTLA-4 and CD86 in B-ALL patients might be candidate parameters for poor prognosis and may serve to refine treatment stratification with intensification of therapy in those patients prone to relapse. PMID: 24283754
  24. no statistically significant difference between brucellosis patients and controls in the allele and genotype distributions of CTLA4, +49A/G (P = 0.859) and CD86, +2379G/C (P = 0.476) was found. PMID: 24298899
  25. Cirrhotic patients with type 2 diabetes have increased expression of monocytic CD86 in comparison with cirrhotic non-diabetic, diabetic and healthy controls. This increases significantly with increase of the stage of the Child-Pugh score. PMID: 24378263
  26. Provide evidence for an involvement of CD40+ and CD86+ B cells in the incidence of stroke and suggest that both pathogenic and protective B cell subsets exist. PMID: 24202305
  27. Our results indicate that the methylation pattern in the CD86 promoter and CpG island is closely related to the expression of this co-stimulatory molecule in keratinocytes. PMID: 23867827
  28. We failed to find any significant association of the 2 CD86 SNPs with RA. PMID: 23661460
  29. Myeloid leukemia cells with a B7-2(+) subpopulation provoke Th-cell responses and become immuno-suppressive through the modulation of B7 ligands. PMID: 23175469
  30. The frequency of the CD86 gene +1057A allele was significantly higher in pancreatic cancer cases than in controls. PMID: 22821131
  31. CD86 and IL-12p70 are key players for T helper 1 polarization and natural killer cell activation by Toll-like receptor-induced dendritic cells. PMID: 22962607
  32. Interaction of CD28 with B7 costimulatory antigen promotes proliferation and survival of activated gammadelta T cells following Plasmodium infection. PMID: 22732586
  33. these results reveal the critical importance of the cytoskeleton-dependent CD86 polarization to the IS and more specifically the K4 motif for effective co-signaling. PMID: 22659416
  34. CD86 represents an important tool for subdividing HSCs in several circumstances, identifying those unlikely to generate a full spectrum of hematopoietic cells. PMID: 22371880
  35. Phe119 and Ser120 in the MIR2 ITM region and Asp244 in the B7-2 JM region contribute to the recognition of B7-2 by MIR2. PMID: 22379101
  36. The +1057G/A polymorphism of the CD86 gene is associated with increased susceptibility to Ewing's sarcoma. PMID: 21870962
  37. Data suggest that expression of CD86, CD80, and CD40 on dendritic cells in normal endometrium is higher than on tumor infiltrating dendritic cells in endometrioid adenocarcinoma; this may reflect roles in antigen presentation/tumor escape. PMID: 22142817
  38. primary liver disease could influence the pre-transplantation levels of sCD86 and sCD95L. High pre-transplantation serum levels of sCD86 could favor the development of episodes of acute rejection. PMID: 22182632
  39. IL-2 upregulates CD86 expression on human CD4(+) and CD8(+) T cells via a receptor-dependent mechanism that involves the NFAT and mammalian target of rapamycin pathways. PMID: 22246628
  40. Yeast-derived beta-glucan lacks cytotoxic effects towards B-lymphoma cells but up-regulation of CD86 suggests maturation of the cells via dectin-1 by the carbohydrate PMID: 22199280
  41. the +1057G/A polymorphism of the CD86 gene is associated with increased susceptibility to osteosarcoma PMID: 21563968
  42. Parasite-induced B7-2 is dependent on Jun N-terminal protein kinase (JNK) but not extracellular signal-regulated kinase or p38 signaling; its expression on human peripheral blood monocytes is dependent on JNK signaling. PMID: 21911468
  43. AA genotype and A allele of CD86 +1057G>A polymorphism may confer a protection against acute kidney allograft rejection in Tunisian patients. PMID: 21525579
  44. Allergen exposure needs to cause weak or moderate cytotoxicity for DD86 and CD54 expression. PMID: 21628959
  45. After surgery the rate of monocytes expressing B7-2 decreased in all the patients PMID: 21540807
  46. genetic polymorphism is associated with risk or protection for chronic obstructive pulmonary disease in Chinese population PMID: 20732370
  47. In the absence of irradiated M. tuberculosis, dendritic cells consist in a major DC-SIGN(high)/CD86(low) and minor DC-SIGN(low)/CD86(high) subpopulations, whereas in the presence of bacteria, there is an enrichment of DC-SIGN(low)/CD86(high) population. PMID: 20212510
  48. In active ulcerative colitis CD86 and ICOS were over-expressed in the intestinal epithelial cells and lamina propria mononuclear cells. PMID: 20388394
  49. Increased amount of CD86 or ICOS positive lamina propria mononuclear cells and enterocytes suggests that co-stimulatory molecules may play a role in the pathogenesis of Crohn disease. PMID: 20019769
  50. Expansion of donor-derived lymphocytic choriomeningitis virus (LCMV)-specific CD4+ and CD8+ T cells is significantly impaired in B7.1/B7.2-deficient T cell receptor (TCR)transgenic recipients, compared with wild-type. PMID: 20601595

Show More

Hide All

Subcellular Location Cell membrane, Single-pass type I membrane protein
Tissue Specificity Expressed by activated B-lymphocytes and monocytes.
Database Links

HGNC: 1705

OMIM: 601020

KEGG: hsa:942

STRING: 9606.ENSP00000332049

UniGene: Hs.171182

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1