Recombinant Human T-lymphocyte activation antigen CD86(CD86),partial

In Stock
Code CSB-AP005161HU
Product Type Immune Checkpoint
Size US$65
Uniprot No. P42081
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Alias T-Lymphocyte Activation Antigen CD86; Activation B7-2 Antigen; B70; BU63; CTLA-4 Counter-Receptor B7.2; FUN-1; CD86; CD28LG2
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to bind Human CTLA-4 in functional ELISA is less than 20 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
Research Area Immunology
Source Mammalian cell
Gene Names CD86
Expression Region 24-247aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 26.69 kDa
Protein Description Extracellular Domain
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation.; FUNCTION
Subcellular Location Cell membrane, Single-pass type I membrane protein
Tissue Specificity Expressed by activated B-lymphocytes and monocytes.
Database Links

HGNC: 1705

OMIM: 601020

KEGG: hsa:942

STRING: 9606.ENSP00000332049

UniGene: Hs.171182

Pathway Toll-like receptor signaling pathway

Related Products

CD86 Antibodies

CD86 Antibodies for Homo sapiens (Human)

CD86 Proteins

CD86 Proteins for Mus musculus (Mouse)

CD86 Proteins for Homo sapiens (Human)

CD86 Proteins for Oryctolagus cuniculus (Rabbit)

CD86 ELISA Kit

CD86 ELISA Kit for Homo sapiens (Human)

CD86 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.