Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
①Loaded Biotinylated Human OX40L-His on AR2G Biosensor, can bind Human OX40-Fc with an affinity constant of 70.3 nM as determined in BLI assay.
②Loaded Cynomolgus OX40L-His on HIS1K Biosensor, can bind Human OX40-Fc with an affinity constant of 165nM as determined in BLI assay.
Alternative Names
TNFRSF4; TXGP1L; Tumor necrosis factor receptor superfamily member 4; ACT35 antigen; OX40L receptor; TAX transcriptionally-activated glycoprotein 1 receptor; CD antigen CD134
Species
Homo sapiens (Human)
Expression Region
29-216aa
Complete Sequence
LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
Tag Info
C-terminal hFc-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with
normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance
and extra fees will be charged.
Datasheet & COA
Please contact us to get it.