Recombinant Human Interleukin-13 (IL13) (Active)

In Stock
Code CSB-AP004321HU
Abbreviation Recombinant Human IL13 protein, partial (Active)
MSDS
Size $290
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 1.5-4.5 ng/ml.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Allergic rhinitis; ALRH; BHR 1; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; IL-13; Il13; IL13_HUMAN; Interleukin 13; Interleukin-13; interleukin13; MGC116786; MGC116788; MGC116789; NC 30; NC30; P 600; P600
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
35-146aa
Complete Sequence
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
Mol. Weight
13.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered PBS,PH7.4
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human IL13 protein is an active protein. It is generated in mammalian cells. The target gene corresponding to the 35-146aa of human IL13 is first co-cloned into a suitable vector with a C-terminal 6xHis-tag gene and introduced into mammalian cells. The mammalian cells are grown to express the protein, which is harvested from the cell lysate. Purification is carried out using affinity chromatography technique. Purity is analyzed with SDS-PAGE, exceeding 95%. It contains less than 0.01 EU/µg of endotoxin as determined by the LAL method. The activity of the purified IL13 protein is validated in a cell proliferation assay using TF‑1 human erythroleukemic cells, with the ED50 of 1.5-4.5 ng/ml.

IL13 is a type II cytokine that plays a crucial role in various biological processes, particularly in the context of allergic asthma and cancer immunotherapy. IL13 shares receptor components and signaling pathways with IL-4, and it has been identified as a central mediator of allergic asthma. Studies have shown that IL13 is necessary and sufficient for the expression of allergic asthma [1].

IL13 has also been investigated in pulmonary fibrosis and granuloma formation. IL13-PE, a recombinant chimeric fusion protein containing human IL13 and a mutated Pseudomonas exotoxin, has been utilized to target IL13 receptor-expressing tumor cells [2]. Furthermore, IL13 is secreted by multiple subsets of immune cells and plays a role in promoting neck cell expansion and metaplasia in the gastric mucosa [3]. It has been implicated in promoting metaplasia development during chronic gastritis by acting directly on gastric epithelial cells [3].

References:
[1] M. Wills‐Karp, J. Luyimbazi, X. Xu, B. Schofield, T. Neben, C. Karpet al., Interleukin-13: central mediator of allergic asthma, Science, vol. 282, no. 5397, p. 2258-2261, 1998. https://doi.org/10.1126/science.282.5397.2258
[2] K. Blease, J. Schuh, C. Jakubzick, N. Lukacs, S. Kunkel, B. Joshiet al., Stat6-deficient mice develop airway hyperresponsiveness and peribronchial fibrosis during chronic fungal asthma, American Journal of Pathology, vol. 160, no. 2, p. 481-490, 2002. https://doi.org/10.1016/s0002-9440(10)64867-5
[3] C. Noto, S. Hoft, K. Bockerstett, N. Jackson, E. Ford, L. Vestet al., Il13 acts directly on gastric epithelial cells to promote metaplasia development during chronic gastritis, Cellular and Molecular Gastroenterology and Hepatology, vol. 13, no. 2, p. 623-642, 2022. https://doi.org/10.1016/j.jcmgh.2021.09.012

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*