Recombinant Human Interleukin-13(IL13),partial

In Stock
Code CSB-AP004321HU
Product Type Interleukin
Size $195Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P35225
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Interleukin-13;IL-13;
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 5 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Research Area Immunology
Source Mammalian cell
Gene Names IL13
Expression Region 25-146aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 14.3 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine
Involvement in disease Allergic rhinitis (ALRH)
Subcellular Location Secreted
Protein Families IL-4/IL-13 family
Database Links

HGNC: 5973

OMIM: 147683

KEGG: hsa:3596

STRING: 9606.ENSP00000304915

UniGene: Hs.845

Pathway Jak-STAT signaling pathway
Fc epsilon RI signaling pathway
IL-17 signaling pathway
Th1 and Th2 cell differentiation

Related Products

IL13 Antibodies

IL13 Antibodies for Homo sapiens (Human)

IL13 Antibodies for Human

IL13 Proteins

IL13 Proteins for Homo sapiens (Human)

IL13 ELISA Kit

IL13 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.