Recombinant Human Interleukin-6(IL6),partial (Active) (GMP)

In StockGMP
Code CSB-AP005841HU
Product Type Interleukin
Size $3929Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P05231
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM Tris-HCl, pH 8.0, 150 mM NaCl.
Alias B-cell stimulatory factor 2,BSF-2,CTL differentiation factor,CDF,Hybridoma growth factor,Interferon beta-2,FN-beta-2,IL-6
Species Homo sapiens (Human)
Biological_Activity Assay #1: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine 7TD1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 107 IU/mg.Assay #2: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine T1165 cells is less than 0.8 ng/ml, corresponding to a specific activity of > 1.25 × 106 IU/mg.
Purity > 98 % by SDS-PAGE and HPLC analyses.
Endotoxin Less than 0.01 EU/μg of rHuIL-6 GMP as determined by LAL method.
Sequence VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Research Area Immunology
Source E.Coli
Gene Names IL6
Expression Region 30-212aa
Tag Info Tag-Free
Mol. Weight 20.8 kDa
Protein Description Partial
PubMed ID 3491322; 3500852; 3538015; 3023045; 3320204; 2789513; 3758081; 3266463; 1291290; 15489334; 3279116; 2610854; 1883960; 7851440; 2472117; 2037043; 8555185; 9159484; 9118960; 9769329; 11001912; 11355017; 12768442; 26091039
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation.
Involvement in disease Rheumatoid arthritis systemic juvenile (RASJ)
Subcellular Location Secreted
Protein Families IL-6 superfamily
Database Links

HGNC: 6018

OMIM: 147620

KEGG: hsa:3569

STRING: 9606.ENSP00000258743

UniGene: Hs.654458

Pathway HIF-1 signaling pathway
Jak-STAT signaling pathway
PI3K-Akt signaling pathway
TNF signaling pathway
Cellular senescence
Hematopoietic cell lineage
IL-17 signaling pathway
NOD-like receptor signaling pathway
Th17 cell differentiation
Toll-like receptor signaling pathway
AGE-RAGE signaling pathway in diabetic complications
FoxO signaling pathway
Inflammatory Pain

Related Products

IL6 Antibodies

IL6 Antibodies for Homo sapiens (Human)

IL6 Antibodies for Human

IL6 Proteins

IL6 Proteins for Homo sapiens (Human)

IL6 ELISA Kit

IL6 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.