Recombinant Mouse Interleukin-7(Il7) (Active)

In Stock
Code CSB-AP004791MO
Product Type Interleukin
Size $195Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P10168
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias IL-7; IL-7 interleukin-7; interleukin-7; Lymphopoietin -1; PBGF
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is less than 5 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
Research Area Immunology
Source Mammalian cell
Gene Names Il7
Expression Region 26-154aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 15.9 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
Subcellular Location Secreted
Protein Families IL-7/IL-9 family
Database Links

KEGG: mmu:16196

STRING: 10090.ENSMUSP00000126219

UniGene: Mm.3825

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Hematopoietic cell lineage

Related Products

Il7 Proteins

Il7 Proteins for Mus musculus (Mouse)

Il7 ELISA Kit

Il7 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.