Purity
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized CD152 at 2 μg/ml can bind Anti-CD152 rabbit monoclonal antibody(CSB-RA213310A0HU), the EC50 of human CD152 protein is 27.14-34.82 ng/ml.
Alternative Names
CTLA4; CD152; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD antigen CD152
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
37-162aa
Target Protein Sequence
AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF
Tag Info
C-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Human CTLA4 (CD152) amino acid Ala37-Phe162 with an N-terminal linker, a TEV+linker, and a C-terminal human IgG1 Fc tag (Pro100-Lys330), was expressed in mammalian cells. The product is the recombinant human CTLA4 protein. Its bioactivity was measured in a functional ELISA. When the recombinant human CTLA4 is immobilized at 2 μg/ml, the anti-CTLA4 rabbit monoclonal antibody can bind to it with an EC50 of 27.14-34.82 ng/ml. It reaches up to 90% in purity determined by SDS-PAGE. On the gel, this CTLA4 protein ran to the molecular weight band of approximately 45 kDa. Its endotoxin content is less than 1.0 EU/ug determined by the LAL method. aND IT IS available now.
CTLA4 is an inhibitory receptor inducibly expressed following T cell activation. CTLA4 either binds to CD80 or CD86, leading to a costimulatory or a co-inhibitory response, respectively. Due to the dampening effect of CTLA4, it plays a crucial role in the regulation of T-cell homeostasis and self-tolerance.