Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4), partial (Active)

In Stock
Code CSB-MP006163HU1
Abbreviation Recombinant Human CTLA4 protein, partial (Active)
MSDS
Size $50
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized CD152 at 2 μg/ml can bind Anti-CD152 rabbit monoclonal antibody(CSB-RA213310A0HU), the EC50 of human CD152 protein is 27.14-34.82 ng/ml. Biological Activity Assay

  • The purity of CTLA4 was greater than 90% as determined by SEC-HPLC.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized CD152 at 2 μg/ml can bind Anti-CD152 rabbit monoclonal antibody(CSB-RA213310A0HU), the EC50 of human CD152 protein is 27.14-34.82 ng/ml.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
CTLA4; CD152; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD antigen CD152
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
37-162aa
Target Protein Sequence
AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF
Mol. Weight
42.5 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CTLA-4 serves as a critical immune checkpoint receptor whose extracellular domain (aa 37–162) mediates the competitive binding to CD80/CD86 that suppresses T-cell activation—making it a central target in immuno-oncology drug development. This recombinant human CTLA-4 construct, expressed in mammalian cells with a C-terminal hFc1 tag, preserves native glycosylation and disulfide-dependent folding essential for conformationally sensitive ligand-receptor interactions. Functional ELISA confirms robust binding activity, with an EC50 of 27.14–34.82 ng/ml against an anti-CD152 monoclonal antibody, supporting use in blocking antibody screening, therapeutic antibody epitope mapping, checkpoint receptor-ligand interaction assays by SPR or BLI, and small-molecule inhibitor discovery campaigns. Purity exceeding 90% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the quality thresholds commonly required for cell-based functional assays and quantitative affinity characterization studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
Gene References into Functions
  1. PTPN22 and CTLA-4 polymorphisms are associated with Autoimmune polyglandular syndromes and differentiate between polyglandular and monoglandular autoimmunity. PMID: 29409002
  2. CTLA4 expression levels was found significantly lower in the alopecia areata patients in Iranian cohort; no association between CTLA4 genetic polymorphism and susceptibility to alopecia areata PMID: 29979892
  3. The CTLA-4 gene +49 A/G polymorphism and the NOD2/CARD15 gene N852S polymorphism were not associated with CD or UC in a Turkish population PMID: 30213296
  4. The CTLA4 gene is suggested to correlate with immune thrombocytopenia through its abnormal expression level instead of gene site mutation. PMID: 30319055
  5. Paget disease is characterized by an intense lymphocytic response, devoid of the immune-suppressive impact of the PD-L1 pathway, but with occasional CTLA-4 expression PMID: 29943071
  6. Depending on the environmental conditions, Mesenchymal stem/stromal cells express different isoforms of CTLA-4 with the secreted isoform (sCTLA-4) being the most abundant under hypoxic conditions. Furthermore, the immunosuppressive function of Mesenchymal stem/stromal cells is mediated mainly by the secretion of CTLA-4. PMID: 30087255
  7. Increased frequency and CTLA-4-expression of Varicella Zoster Virus-specific T cells from cerebrospinal fluid or blood are specifically found in patients with Varicella Zoster Virus-related Central Nervous System-infection. PMID: 28845512
  8. Rs56102377 in the 3'-UTR of CTLA4 may act as a protective factor by disrupting the regulatory role of miR-105 in CTLA4 expression. PMID: 30355938
  9. The present work showed in West Algerian population that the HLA-B27 antigen and the variation in the CTLA4 3'UTR region played an important role in the ankylosing spondylitis susceptibility. The heterogeneity of this disease is deduced by genetic difference found between B27+ and B27- groups. PMID: 29675891
  10. High CTLA4 expression is associated with Melanoma. PMID: 29150430
  11. CTLA4 protein had significantly higher serum level in recurrent spontaneous abortion patients than in healthy controls. In recurrent spontaneous abortion patients, AA genotype carriers had higher CTLA4 serum level than that GG genotype carriers. Minor alleles of CTLA4 polymorphisms might inhibit the recurrent spontaneous abortion susceptibility via upregulated the protein expression level. PMID: 30334961
  12. The results in our meta-analysis indicated that CTLA4 +49A/GG allele/AA genotype was associated with the risk of colorectal cancer in the Asian population and overall populations PMID: 29970719
  13. The CTLA4 -318/C/T SNP was associated with an increased risk to develop IgAN, while the CT60 G/A genotype significantly associated with the risk for higher proteinuria PMID: 29539619
  14. This review summarizes the current literature relevant to T cell exhaustion in patients with Hepatitis B virus (HBV)related chronic hepatitis, and discusses the roles of CTLA4 in T cell exhaustion. [review] PMID: 29786112
  15. Study provides evidence that CTLA4 +49 A/G (Thr/Ala) polymorphism was strongly associated with T1diabetes in south India. PMID: 29603038
  16. gene polymorphism is associated with psoriasis in Turkish population PMID: 29850619
  17. The mRNA expression of FAS was lower in patients with TP53 mutation than TP53 wild-type. Our findings suggest that TP53 mutation is a potential negative predictor of metastatic melanoma treated with CTLA-4 blockade. PMID: 29793878
  18. TSA results indicated that CTLA-4 +49A/G should be considered as a biomarker for HT, whereas both the CT60 and -318C/T SNPs warrant confirmation by further studies PMID: 29461867
  19. susceptibility to RSA was subject to the synthetic regulation of chromosomal aberrations and genetic mutations within CLTA-4 and Foxp3, suggesting that the conduction of karyotype analysis and genetic detection for RSA patients could effectively guide effective RSA counseling and sound child rearing. PMID: 29476189
  20. CTLA4 missense variant significantly associates with inhibitor development in Argentine patients with severe haemophilia A PMID: 28220572
  21. Study suggests that miR-487a-3p might repress CTLA4 and FOXO3 by binding to their 3'UTRs and contribute to the development of T1D. PMID: 29859273
  22. the expression of mCTLA-4 in skin lesion inversely correlated with the severity of psoriasis and CTLA-4 might play a critical role in the disease severity of psoriasis. PMID: 29305257
  23. Hematopoietic stem cell transplantation for CTLA4 deficiency with pathogenic mutations resulting in complex immune dysregulation syndromes. PMID: 27102614
  24. Our results suggest that CTLA-4 may be involved in lipid metabolism and affect Type 2 diabetes mellitus (T2DM)disease progression and/or the development of diabetic complications although this gene does not represent a major risk factor for T2DM. PMID: 29511375
  25. rs231775, rs4553808 and rs5742909 but not rs3087243 and rs733618 were significantly related to cancer risk. In analyses stratified by ethnicity, both rs231775 and rs4553808 were significant susceptibility polymorphisms in an Asian population but not in a Caucasian population. PMID: 29794444
  26. Paper analyses results of serum cytokines and lymphocyte apoptosis study in nodular goiter against the background of autoimmune thyroiditis and thyroid adenoma based on the cell preparedness to apoptosis, the number of apoptotic lymphocytes and the content of proapoptotic tumor necrosis factor-alpha, interleukins in serum, considering the polymorphism of BCL-2, CTLA-4 and APO-1 genes. PMID: 29250672
  27. -318C/T polymorphism of CTLA-4 gene might play a significant role in the development of SLE in the Iranian patients. PMID: 24400885
  28. the immune response to specific miHA mismatches is modulated by the CTLA-4 genotype of the donor PMID: 28827064
  29. It was concluded that the abnormal expression of endometrial E2A existed in mid-secretory endometrium of women with recurrent miscarriage, and there was a positive correlation between E2A and FOXP3, and E2A and CTLA-4, suggesting the possible regulatory role of E2A in endometrium receptivity. PMID: 29270752
  30. This study shows a significant overexpression of CTLA-4 in >50% of breast carcinomas with no such overexpression of CTLA-4 in benign breast tissues. PDL-1 staining is seen in only a small number of invasive ductal carcinomas (4.1%). PMID: 29672601
  31. CTLA4 gene is suggested to correlated with polycyctic ovary syndrome, and influence polycycstic ovary syndrome through regulating obesity and the homeostatic model assessment for insulin resistance in a novel way. PMID: 30024513
  32. We describe three cases of patients with mRCC treated with anti-PD-1 antibody therapy in combination with targeted therapy (bevacizumab), anti-cytotoxic T lymphocyte antigen 4 therapy (ipilimumab), or radiotherapy. PMID: 29146617
  33. The CTLA-4c.49A>G and CTLA-4g.319C>T single nucleotide polymorphisms might be considered as low risk susceptibility locus for prostate cancer PMID: 28101800
  34. anti-CTLA4/anti-PD-1/PD-L1 combinations versus anti-PD-1/PD-L1 monotherapy was selected as a factor independent of TMB for predicting better RR (77% vs. 21%; P = 0.004) and PFS (P = 0.024). Higher TMB predicts favorable outcome to PD-1/PD-L1 blockade across diverse tumors. PMID: 28835386
  35. Polymorphisms at IL10 (-1082 G>A), IL4 (-589 C>T), CTLA4 (+49A>G), and DAO (+8956 C>G) genes were studied in 55 cases. PMID: 28750137
  36. this study showed that CTLA-4 + 49A/G polymorphism was not correlated with greater genetic risk for leprosy. However, GG genotype was associated with older age, older age of onset and over-representation in male in an Iranian Azeri population. PMID: 29104093
  37. Our meta-analysis suggested that the +49 A/G polymorphism in CTLA4 might be a risk factor for asthma susceptibility, especially in Asian individuals, children, and patients with atopy PMID: 29995780
  38. Genetic polymorphisms of CTLA-4 gene on the nucleotide 49 at codon 17 of exon 1, TSHR gene SNP rs2268458 of intron 1, number of regulatory T cells and TRAb levels play a role as risk factors for relapse in patients with Graves' disease. PMID: 29093229
  39. These results demonstrate that POSTN promotes the osteogenic differentiation of mesenchymal stem cells (MSCs) and that CTLA4 enhances the ectopic osteogenesis of MSCs-CTLA4-based tissue-engineered bone. PMID: 28687929
  40. the polymorphism -318C/T of CTLA-4 gene is associated with RBC alloimmunization among sickle cell disease patients. This highlights the role played by CTLA-4 on post-transfusion alloantibody development PMID: 28815969
  41. Meta-analysis found that CTLA4 -318C/T gene polymorphism is not associated with the risk of acute rejection in renal transplantation in overall populations. PMID: 28449371
  42. Our goal was to stimulate antitumor immunity by combining SS1P or LMB-100 with anti-CTLA-4. We constructed a BALB/c breast cancer cell line expressing human mesothelin (66C14-M), which was implanted in one or two locations. SS1P or LMB-100 was injected directly into established tumors and anti-CTLA-4 administered i.p. In mice with two tumors, one tumor was injected with immunotoxin and the other was not. PMID: 28674083
  43. Taken together, we found that Id3+ and CTLA-4+ endometrial cells were significantly higher in women with repeated implantation failure and recurrent miscarriage, suggesting the negative roles of these angiogenesis and immune tolerance markers involving in regulating endometrium receptivity. PMID: 28224680
  44. study indicated that the polymorphisms of rs231775 and rs231725 would be the risk factors of Primary Biliary Cholangitis [meta-analysis] PMID: 28642883
  45. Suggest that genetic polymorphisms of CTLA-4 function as sex-dependent risk factors for development of acute rejection in an Iranian kidney transplant population. PMID: 28031007
  46. A phase Ib study of dasatinib plus ipilimumab in patients with gastrointestinal stromal tumor (GIST) and other sarcomas was performed on the basis of preclinical data demonstrating that combined KIT and CTLA-4 blockade is synergistic. PMID: 28007774
  47. The data we presented here showed that CTLA-4 was highly expressed in regulatory T cells and PD-1 decreased in CD8+ T cells in peripheral blood of SCLC patients, suggesting their unique mechanisms involved in immune regulation. PMID: 29167005
  48. Significant differences in the CpG-methylation patterns between tumor tissues and matched controls were observed for CTLA4 showing a decreased methylation of this gene in non-small cell lung cancer patients. Expression studies confirmed that hypomethylation also resulted in increased expression of CTLA4. PMID: 28503213
  49. The polymorphisms +49 G/A, -1661 A/G and -318 C/T may elevate the susceptibility to BC, but the polymorphism CT60 G/A may offer protection against the cancer. PMID: 28416762
  50. In children with idiopathic nephrotic syndrome (INS), serum CTLA-4 concentration significantly increased at remission compared with onset. Furthermore, a positive significant correlation was observed between Treg number and serum CTLA-4 level. This suggests that Treg and CTLA-4 are involved in the induction of remission in INS. PMID: 28544686

Show More

Hide All

Involvement in disease
Systemic lupus erythematosus (SLE); Diabetes mellitus, insulin-dependent, 12 (IDDM12); Celiac disease 3 (CELIAC3); Autoimmune lymphoproliferative syndrome 5 (ALPS5)
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Note=Exists primarily an intracellular antigen whose surface expression is tightly regulated by restricted trafficking to the cell surface and rapid internalization.
Tissue Specificity
Widely expressed with highest levels in lymphoid tissues. Detected in activated T-cells where expression levels are 30- to 50-fold less than CD28, the stimulatory coreceptor, on the cell surface following activation.
Database Links

HGNC: 2505

OMIM: 109100

KEGG: hsa:1493

STRING: 9606.ENSP00000303939

UniGene: Hs.247824

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*