Name: Recombinant Human Delta-like protein 3(DLL3),partial
Brand: CUSABIO
SKU: CSB-YP882142HU

Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	DLL3
Uniprot No.	Q9NYJ7
Research Area	Developmental Biology
Alternative Names	Delta Drosophila like 3; Delta like 3 Drosophila; Delta like 3 homolog Drosophila; Delta like 3 protein; Delta like protein 3 precursor; Delta-like protein 3; Delta3; Dll3; DLL3_HUMAN; Drosophila Delta homolog 3; SCDO1; SCOD1; Spondylocostal dysostosis autosomal recessive
Species	Homo sapiens (Human)
Source	Yeast
Expression Region	27-492aa
Target Protein Sequence	AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	50.5kDa
Protein Length	Extracellular Domain
Tag Info	N-terminal 6xHis-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	3-7 business days
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I have a question for item CSB-YP882142HU Recombinant human Delta-like protein 3, lyophilized and glycerol free.
Do you have instructions on how this item should be reconstituted that you could share?

Very nice to receive your inquiry. We have listed recommended reconstitution method in COA. Please kindly check the datasheet&COA.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.
We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

I have a questions about item CSB-YP882142HU Recombinant human Delta-like protein 3 and ask:
What strain of yeast is used to produce this protein?

Thanks for your inquiry，We use Pichia to produce this protein.

We are interested in CSB-YP882142HU - Recombinant human Delta-like protein 3 supplied in a lyophilized form without glycerol. Would it be possible to obtain this product in such a form?

Very nice to receive your inquiry.
If you would like this protein supplied in lyophilized form without glycerol, please kindly remark this requirement when sending your PO.

Would you be able to share how CSB-YP882142HU - Recombinant human Delta-like protein 3 was validated? Was an antibody used to detect this protein? If so, which antibody?

Very nice to receive your inquiry.
1) In the cloning phase, we determine that there is no problem with clones by Sequencing.
2) In the protein expression stage, we perform SDS-PAGE detection.
3) We haven't used antibody to test this protein yet. If customer has demand, we could perform Western Blot free of charge.
We will use our home-made specific antibody (CSB-PA882142LA01HU) or His-tag antibody to test this protein in WB.
Please kindly remark this requirement when sending your PO.

Target Background

Function	Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm.
Gene References into Functions	these results reveal that DLL3 is expressed in tumor specimens from most patients with small cell lung cancer PMID: 29290251 Results indicated that DLL3 expression was silenced in hepatocellular carcinoma (HCC) cells by DNA methylation and was more readily affected by histone acetylation than histone methylation (H3K9me2 or H3K27me3). PMID: 29512761 our results indicated epidermal growth factor-like domain multiple 7 protein participates in growth hormone-secreting pituitary adenoma proliferation and invasion regulation via Notch2/DLL3 signaling pathway. These findings raised the possibility that epidermal growth factor-like domain multiple 7 protein might serve as a useful biomarker to assess growth hormone-secreting pituitary adenoma invasion and prognosis PMID: 28705113 The Dll3 was rarely detectable in the para-carcinoma tissues, but positive in 82.1% of non-small cell cancer tissues. PMID: 28007595 Both global haplotype and individual haplotype analyses showed that the haplotypes of SNP1/SNP2/SNP3/SNP4/SNP5 did not correlate with the disease (P >0.05). Together, these data suggest that genetic variants of the DLL3 gene are not associated with CS in the Chinese Han population. PMID: 27472720 DLL3 was silenced by methylation in human human hepatocellular carcinoma and it negatively regulates the growth of human hepatocellular carcinoma cells. PMID: 23337976 We suggest that the three human DLL3 mutations associated with spondylocostal dysplasia are also functionally equivalent to the Dll3(neo) null allele in mice. PMID: 11923214 mutations in DLL3 cause a consistent pattern of abnormal vertebral segmentation in spondylocostal dysostosis PMID: 12746394 no novel or previously described mutations are present in our cohort, indicating that DLL3 mutations may not be a major cause of congenital scoliosis. PMID: 15717203 The intracellular region of Notch ligands Dll1 and Dll3 regulates their trafficking and signaling activity PMID: 18676613 Show More Hide All
Involvement in disease	Spondylocostal dysostosis 1, autosomal recessive (SCDO1)
Subcellular Location	Membrane; Single-pass type I membrane protein.
Database Links	HGNC: 2909 OMIM: 277300 KEGG: hsa:10683 STRING: 9606.ENSP00000205143 UniGene: Hs.127792

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-YP882142HU
Size	US$1298
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP882142HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) DLL3. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP882142HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) DLL3.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Delta-like protein 3(DLL3),partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage