Recombinant Human papillomavirus 11 Protein E7 (E7)

In Stock
Code CSB-EP366089HMG
Abbreviation Recombinant Human papillomavirus 11 E7 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Species
Human papillomavirus type 11
Source
E.coli
Expression Region
1-98aa
Target Protein Sequence
MHGRLVTLKDIVLDLQPPDPVGLHCYEQLEDSSEDEVDKVDKQDAQPLTQHYQILTCCCGCDSNVRLVVECTDGDIRQLQDLLLGTLNIVCPICAPKP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human papillomavirus 11 Protein E7 is expressed in E. coli and covers the complete protein sequence from amino acids 1-98. The protein carries an N-terminal 10xHis-tag and a C-terminal Myc-tag, which helps with both purification and detection processes. SDS-PAGE analysis shows the protein achieves greater than 90% purity, which appears to support reliable performance in research settings. This protein is for research use only.

HPV11 Protein E7 plays what seems to be a central role in studying how viruses interact with their host cells. E7 disrupts normal cellular control mechanisms, particularly those involved in cell cycle regulation. Its ability to alter host cell functions makes it an important research target for scientists trying to understand viral disease development and explore possible treatments.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Human papillomavirus 11 Protein E7 is an oncoprotein that requires precise folding, proper zinc-binding domain formation (via two CXXC motifs), and specific tertiary structure for its functional activity in cell transformation and binding to host proteins like Rb. The E. coli expression system cannot provide the eukaryotic folding environment, and more critically, cannot support the zinc incorporation essential for E7's structural stability and function. The dual N-terminal 10xHis-tag and C-terminal Myc-tag may cause steric interference with the protein's functional domains. While the full-length protein (1-98aa) contains all functional residues, the probability of correct folding with functional bioactivity is extremely low without experimental validation of zinc incorporation and proper tertiary structure.

1. Antibody Development and Validation

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional protein folding. The full-length protein provides comprehensive epitope coverage for generating E7-specific antibodies. However, antibodies may not recognize conformational epitopes of the native, zinc-bound E7 protein.

2. Biochemical Characterization and Structural Studies

Basic biophysical analysis can be performed, but will not reflect native E7 structure. Techniques like circular dichroism spectroscopy may assess secondary structure, but the lack of zinc incorporation means the protein will not adopt its native conformation. Results will describe an artificial construct rather than the physiological oncoprotein.

3. ELISA-Based Detection Assay Development

This application is feasible but has limitations. ELISA development relies on antigenic recognition, but the misfolded protein may not present native conformational epitopes, potentially reducing assay sensitivity for detecting antibodies against physiological E7.

Final Recommendation & Action Plan

This E. coli-expressed HPV11 E7 with dual tags is unsuitable for functional studies due to the essential requirement for zinc incorporation that cannot be met in this expression system. The protein will lack the proper zinc-binding and tertiary structure necessary for authentic oncoprotein function. Applications 1 and 3 can proceed, but with awareness that they will primarily target linear epitopes. Application 2 provides only a basic characterization of the misfolded protein. For reliable E7 research, use mammalian-expressed protein with verified zinc incorporation or implement refolding protocols with zinc supplementation followed by rigorous functional validation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta).
Subcellular Location
Host cytoplasm. Host nucleus.
Protein Families
Papillomaviridae E7 protein family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*