Recombinant Human papillomavirus 11 Protein E7 (E7)

In Stock
Code CSB-EP366089HMG
Abbreviation Recombinant Human papillomavirus 11 E7 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Species
Human papillomavirus type 11
Source
E.coli
Expression Region
1-98aa
Target Protein Sequence
MHGRLVTLKDIVLDLQPPDPVGLHCYEQLEDSSEDEVDKVDKQDAQPLTQHYQILTCCCGCDSNVRLVVECTDGDIRQLQDLLLGTLNIVCPICAPKP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human papillomavirus 11 Protein E7 is expressed in E. coli and covers the complete protein sequence from amino acids 1-98. The protein carries an N-terminal 10xHis-tag and a C-terminal Myc-tag, which helps with both purification and detection processes. SDS-PAGE analysis shows the protein achieves greater than 90% purity, which appears to support reliable performance in research settings. This protein is for research use only.

HPV11 Protein E7 plays what seems to be a central role in studying how viruses interact with their host cells. E7 disrupts normal cellular control mechanisms, particularly those involved in cell cycle regulation. Its ability to alter host cell functions makes it an important research target for scientists trying to understand viral disease development and explore possible treatments.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. In Vitro Protein-Protein Interaction Studies

This recombinant HPV11 E7 protein works well for investigating how it interacts with cellular targets through pull-down assays that take advantage of the N-terminal 10xHis tag. Having both His and Myc tags gives researchers flexibility in detection and purification approaches during biochemical experiments. Scientists can use this protein to examine E7's binding partners in cell lysates or when working with purified cellular proteins. The high purity level (>90%) likely reduces interference from bacterial contaminants, though some background may still be present in sensitive assays.

2. Antibody Development and Validation

The recombinant E7 protein appears to be well-suited as an antigen for creating monoclonal or polyclonal antibodies that specifically recognize HPV11 E7. The C-terminal Myc tag offers a built-in control for protein detection and can help validate antibody specificity through competitive binding experiments. Since this represents the full-length protein (1-98aa), it should preserve the natural epitopes that may be essential for developing antibodies with proper specificity and binding strength. Bacterial expression provides a relatively inexpensive antigen source for immunization studies, though researchers should consider that bacterial folding might not perfectly mimic native protein structure.

3. Biochemical Characterization and Structural Studies

The dual-tagged E7 protein can be used for comprehensive biochemical analysis, including protein stability tests, folding studies, and various biophysical measurements. The N-terminal His tag makes purification straightforward for analytical techniques like mass spectrometry, circular dichroism spectroscopy, or dynamic light scattering. Scientists can test how the protein behaves under different buffer conditions and pH levels to find optimal experimental conditions. While the high purity level makes this protein appropriate for quantitative biochemical work, some caution may be needed when interpreting results since bacterial expression systems don't always produce proteins with native post-translational modifications.

4. ELISA-Based Detection Assay Development

The recombinant HPV11 E7 protein can function as either a capture antigen or standard in enzyme-linked immunosorbent assays for research purposes. The Myc tag makes sandwich ELISA formats possible using anti-Myc antibodies for detection, while the His tag allows for oriented attachment to nickel-coated surfaces. This protein helps in developing and refining ELISA protocols for measuring E7-specific immune responses in preclinical vaccine research. The known concentration and high purity should support consistent assay performance, though optimization may still be needed for different experimental conditions.

5. Cell-Free Functional Assays

This recombinant E7 protein works in cell-free biochemical assays designed to study its molecular characteristics and potential enzymatic activities. The protein can be tested in binding experiments with nucleic acids or other cellular components to explore E7's molecular mechanisms. The dual tagging system makes it easier to track and measure the protein in complex reaction mixtures. Researchers can use this protein in side-by-side comparisons with E7 proteins from other HPV types to identify type-specific differences in biochemical behavior, though such comparisons may be limited by expression system variations.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta).
Subcellular Location
Host cytoplasm. Host nucleus.
Protein Families
Papillomaviridae E7 protein family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*